Align Homoserine O-acetyltransferase; HAT; Homoserine transacetylase; HTA; EC 2.3.1.31 (characterized)
to candidate HSERO_RS00455 HSERO_RS00455 homoserine O-acetyltransferase
Query= SwissProt::Q12XS2 (488 letters) >FitnessBrowser__HerbieS:HSERO_RS00455 Length = 379 Score = 376 bits (965), Expect = e-109 Identities = 184/365 (50%), Positives = 245/365 (67%), Gaps = 4/365 (1%) Query: 5 SVGIVATNYHTIEGEFQLEGGHTLKNIRLAYETYGNLNKEKSNAILVCHALTGDAHAAGR 64 S+GIV+ L+GG L + L YETYG LN +KSNA+LVCHAL H AG Sbjct: 2 SIGIVSPQVMHFAEPLPLQGGSALADYSLTYETYGTLNADKSNAVLVCHALNASHHVAGV 61 Query: 65 HSDDDKKPGWWDDIIGPGKALDTDRYFVLCSNVLGGCKGTTGPASLDPDTGRQYGITFPV 124 ++DD GWWD+++GPGK+LDTDR+FV+ N LG C G+TGP +P TG+ YG FPV Sbjct: 62 YADDPDNVGWWDNMVGPGKSLDTDRFFVIGVNNLGSCFGSTGPMHANPATGKPYGADFPV 121 Query: 125 ITIRDMVNVQKRLIDHMGITTLFAVVGGSMGGMQTLQWCVAYPELVKKAVVIASTAVSSP 184 +T+ D VN Q RL D +GIT AV+GGS+GGMQ L W + YP+ ++ +VIAST S Sbjct: 122 VTVEDWVNAQARLADRLGITCFAAVMGGSLGGMQALAWSMMYPDRLRHCLVIASTPKLSA 181 Query: 185 QQIAFNEVGRNAIISDPDWNGGDYY-EGEPPVNGLSTARMIAHITYLSDASMHEKFGRRL 243 Q IAFN+V R AI++DP ++GGD+Y G P NGL ARM+ HITYLSD M EKFGR L Sbjct: 182 QNIAFNDVARQAILTDPQYHGGDFYAHGVVPKNGLRVARMVGHITYLSDDDMAEKFGRDL 241 Query: 244 QQGESYKFDMSNDFQVGSYLKYQGDTFTGRFDANSYLYATKAVDYFD--LSMNGSLAEGL 301 + G+ Y+F DF++ SYL+YQGD F+ FDAN+YL TKA+DYFD G LA+ L Sbjct: 242 RSGQ-YQFGYGVDFEIESYLRYQGDKFSTYFDANTYLLITKALDYFDPAREFGGDLAKAL 300 Query: 302 KYVQAKMLVISITSDWLYSPYHSKKIVEGLTVKEHDVSYREIESSYGHDAFLLESGQINY 361 +AK L++S T+DW +SP S+++V+ L + VSY EI++ +GHDAFLL+ + Sbjct: 301 ACTKAKFLLVSFTTDWRFSPERSREMVQALVANKRRVSYAEIDAPHGHDAFLLDDARYMK 360 Query: 362 VIHNF 366 V+ + Sbjct: 361 VVREY 365 Lambda K H 0.318 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 537 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 488 Length of database: 379 Length adjustment: 32 Effective length of query: 456 Effective length of database: 347 Effective search space: 158232 Effective search space used: 158232 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
Align candidate HSERO_RS00455 HSERO_RS00455 (homoserine O-acetyltransferase)
to HMM TIGR01392 (metX: homoserine O-acetyltransferase (EC 2.3.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01392.hmm # target sequence database: /tmp/gapView.28705.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01392 [M=351] Accession: TIGR01392 Description: homoserO_Ac_trn: homoserine O-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-143 463.7 0.0 2.3e-143 463.5 0.0 1.0 1 lcl|FitnessBrowser__HerbieS:HSERO_RS00455 HSERO_RS00455 homoserine O-acety Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS00455 HSERO_RS00455 homoserine O-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 463.5 0.0 2.3e-143 2.3e-143 3 349 .. 15 365 .. 13 367 .. 0.98 Alignments for each domain: == domain 1 score: 463.5 bits; conditional E-value: 2.3e-143 TIGR01392 3 eeltlesGevlsevevayktyGtlnaerdNavlvcHaltgsahvagkadeedk..GWWdellGpgral 68 e+l l+ G+ l +++++y+tyGtlna+++NavlvcHal +s+hvag + ++ + GWWd+++Gpg++l lcl|FitnessBrowser__HerbieS:HSERO_RS00455 15 EPLPLQGGSALADYSLTYETYGTLNADKSNAVLVCHALNASHHVAGVYADDPDnvGWWDNMVGPGKSL 82 7899******************************************998776678************* PP TIGR01392 69 dtsryfvvclNvlGsckGstgPlsinpetgkpygaefPlvtirDlvkaqkalldsLgveklaavvGgS 136 dt+r+fv+++N+lGsc GstgP+ +np+tgkpyga+fP+vt++D+v+aq++l+d+Lg++ +aav+GgS lcl|FitnessBrowser__HerbieS:HSERO_RS00455 83 DTDRFFVIGVNNLGSCFGSTGPMHANPATGKPYGADFPVVTVEDWVNAQARLADRLGITCFAAVMGGS 150 ******************************************************************** PP TIGR01392 137 lGGmqalewalsypervkkivvlatsarasaqaiafnevqrqailsDpeyndGeyaeee.qPekGLal 203 lGGmqal w+++yp+r+++++v+a+++++saq+iafn+v+rqail+Dp+y++G+++ ++ P++GL++ lcl|FitnessBrowser__HerbieS:HSERO_RS00455 151 LGGMQALAWSMMYPDRLRHCLVIASTPKLSAQNIAFNDVARQAILTDPQYHGGDFYAHGvVPKNGLRV 218 **********************************************************99******** PP TIGR01392 204 ARmlalltYrseesleerfgreakseeslassleeefsvesylryqgkkfverFdAnsYllltkaldt 271 ARm++++tY+s+++++e+fgr+ +s ++++ + +f++esylryqg+kf + FdAn+Yll+tkald+ lcl|FitnessBrowser__HerbieS:HSERO_RS00455 219 ARMVGHITYLSDDDMAEKFGRDLRSG-QYQFGYGVDFEIESYLRYQGDKFSTYFDANTYLLITKALDY 285 ************************99.77999************************************ PP TIGR01392 272 hdlargrrdslkealkkikapvlvvgiesDllftleeqeelakalkaakle..yaeieseeGHDaFll 337 +d ar+ ++l++al+ +ka++l+v++++D++f++e+++e+++al a+k + yaei+ ++GHDaFll lcl|FitnessBrowser__HerbieS:HSERO_RS00455 286 FDPAREFGGDLAKALACTKAKFLLVSFTTDWRFSPERSREMVQALVANKRRvsYAEIDAPHGHDAFLL 353 *********************************************99988888*************** PP TIGR01392 338 ekekveeliref 349 +++++++++re+ lcl|FitnessBrowser__HerbieS:HSERO_RS00455 354 DDARYMKVVREY 365 *********987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (379 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.90 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory