Align [amino group carrier protein]-C-terminal-L-glutamyl-γ-L-lysine aminotransferase (EC 2.6.1.118; EC 2.6.1.124) (characterized)
to candidate HSERO_RS05420 HSERO_RS05420 4-aminobutyrate aminotransferase
Query= metacyc::MONOMER-18314 (387 letters) >FitnessBrowser__HerbieS:HSERO_RS05420 Length = 426 Score = 201 bits (510), Expect = 4e-56 Identities = 128/388 (32%), Positives = 205/388 (52%), Gaps = 34/388 (8%) Query: 22 VWDIEGRRYLDFHTGIGVAFLGHRNPIILEYLKNQLENISILSTSFSTPIKD--EMLQAL 79 +WD+EGRR++DF GI V GHR+P +L+ ++ Q++ + + P E+ + + Sbjct: 38 LWDVEGRRFIDFAAGIAVLNTGHRHPKLLDAMRAQMDKFTHTAYQI-VPYASYVELAERI 96 Query: 80 DKVKPDKMDN-AMLLNSGTEAVEAALKTARKITGRKKIIAFKNAFHGRTAGSLSVTWN-K 137 +++ P ++G EAVE A+K AR TGR +IAF FHGRT +++T Sbjct: 97 NRLTPGNYPKKTAFFSTGAEAVENAIKIARAHTGRPGVIAFAGGFHGRTMMGMALTGKVA 156 Query: 138 KYREPFEPLVGPVEFLTFNN-------------IEDLSKIDNET---AAVIVEPIQGESG 181 Y+ F P G V + + ++ L K D E AA+I+EP+QGE G Sbjct: 157 PYKLGFGPFPGDVFHAPYPSALHGITSEDALEAVKGLFKSDIEAKRVAAIILEPVQGEGG 216 Query: 182 VIPANIEFMKALKEKTENTGSLLIFDEIQTGFGRTGKLWAYKHYNIVPDILTAGKAIGGG 241 A +FM+ L+ + G LLI DE+Q+G+GRTGKL+A +HY+++PD++T K++ GG Sbjct: 217 FYAAPADFMRGLRALCDEHGILLIADEVQSGYGRTGKLFAMEHYDVLPDLMTMAKSLAGG 276 Query: 242 FPVSVVFLPDHIANKLEEGDHGSTYGGNPMAMAAVTAACKVIEKENVVEQANQKGQQFSN 301 P+S V I + G G TY GNP+A+A+ A V+E+E +V + + G + Sbjct: 277 MPLSAVNGRAEIMDAPAPGGLGGTYAGNPLAIASALAVLDVMEEEQLVTRGQRLGDKLQE 336 Query: 302 ILVKNLADLKVVREVRGKGLMIGIDIRFQPG----------QVLKYLQEKGILAVKAGS- 350 L + + + + EVRG G M+ ++ P +V ++ G+L + GS Sbjct: 337 HLKELRSSVPQIAEVRGVGAMVAVEFA-DPATGKPDAEYTKKVQQHALNNGLLLLTCGSY 395 Query: 351 -TVIRFLPSYLITYENMEEASNVLREGL 377 VIRFL I M+EA +L + + Sbjct: 396 GNVIRFLFPLTIPDTVMDEALGILAKAI 423 Lambda K H 0.317 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 414 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 426 Length adjustment: 31 Effective length of query: 356 Effective length of database: 395 Effective search space: 140620 Effective search space used: 140620 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory