Align Putative [LysW]-L-2-aminoadipate/[LysW]-L-glutamate phosphate reductase; EC 1.2.1.- (uncharacterized)
to candidate HSERO_RS19210 HSERO_RS19210 N-acetyl-gamma-glutamyl-phosphate reductase
Query= curated2:A0RWW0 (348 letters) >FitnessBrowser__HerbieS:HSERO_RS19210 Length = 345 Score = 243 bits (619), Expect = 7e-69 Identities = 134/349 (38%), Positives = 195/349 (55%), Gaps = 7/349 (2%) Query: 1 MKVGVVGASGYVGGETLRLLVNHPDVEIAAVTSRQHVGEYLHRVQPSLRGFTDLTFSELD 60 +KVG+VG +GY G E LR+ HP+ + AVTSR+ G + + PSLRG D+ FS D Sbjct: 2 IKVGIVGGTGYTGVELLRIFATHPEARVQAVTSRKEDGMPVAEMYPSLRGRVDVAFSSPD 61 Query: 61 YDRLSDSCDLVFTAVPHGTATDIVRALYDRDIKVIDLSADYRLHDPADYTKWYGWEHPHP 120 RL+D CD+VF A PHG A L +KVIDL+AD+R+ D A + KWY H Sbjct: 62 KARLTD-CDVVFFATPHGVAMAQAPELVAAGVKVIDLAADFRMQDVAAFEKWYKLPHSCT 120 Query: 121 DYLSKSVFGIPELHREEIRSAKLVSCPGCMAVTSILALAPPVREGLVDTEHIVVDSKIGS 180 D L ++ +G+PEL+RE IR A++V PGC T L AP ++ G++D H++ D K G Sbjct: 121 DLLKEAAYGLPELNREAIRKARVVGNPGCYPTTMQLGYAPLLKAGVIDASHLIADCKSGV 180 Query: 181 SGAG--AGAGTAHAMRAGVIRPYKPAKHRHTGEIEQELSGIAGKKIRVSMSPHAVDVVRG 238 SGAG A + + + Y + HRH+ E + LS + K+ + +PH V ++RG Sbjct: 181 SGAGRKAELSLLFSEASDNFKAYGVSGHRHSPETIERLSHLTSDKVGLLFTPHLVPMIRG 240 Query: 239 ILCTNHVFLTREASEKDLWKMYRQAYGEERFVRLIRDKKGLYKFPDPKFLVGSNFCDIGF 298 + T + LT+E L ++ AY +E FV D P+ + SN + Sbjct: 241 MHSTLYARLTKEIDNAALQALFEDAYKDEPFV----DVLPFGAHPETRTTRASNMLRLAV 296 Query: 299 DLDEDNNRLVAISASDNLMKGAAGSAIQNMNIMAGLDEMSGLRYTPLTP 347 D + +V + DNL+KGA+G A+Q MN+M GLDE +GL+ P+ P Sbjct: 297 HRPGDGDTVVVLVVQDNLVKGASGQAVQCMNLMFGLDETTGLQQVPVLP 345 Lambda K H 0.320 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 271 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 348 Length of database: 345 Length adjustment: 29 Effective length of query: 319 Effective length of database: 316 Effective search space: 100804 Effective search space used: 100804 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory