Align phosphoserine transaminase (EC 2.6.1.52) (characterized)
to candidate HSERO_RS18435 HSERO_RS18435 MFS transporter
Query= BRENDA::P23721 (362 letters) >FitnessBrowser__HerbieS:HSERO_RS18435 Length = 370 Score = 399 bits (1025), Expect = e-116 Identities = 205/371 (55%), Positives = 263/371 (70%), Gaps = 14/371 (3%) Query: 4 IFNFSSGPAMLPAEVLKQAQQELRDWNGLGTSVMEVSHRGKEFIQVAEEAEKDFRDLLNV 63 ++NFS+GPA+LP EVL+QA E+ DW+G G SVME+SHRGKE++ + E A D R L+N+ Sbjct: 2 VYNFSAGPAVLPKEVLQQAADEMLDWHGSGMSVMEMSHRGKEYMSIIEAALADVRALMNI 61 Query: 64 PSNYKVLFCHGGGRGQFAAVPLNILGDKT--------TADYVDAGYWAASAIKEAKKYCT 115 PSNYKVLF GG + A +P+N+ ++ ADY++ G W+ +IKEA +YCT Sbjct: 62 PSNYKVLFLQGGAIAENAIIPMNLAALRSPAGKHEVGVADYINTGSWSTKSIKEAGRYCT 121 Query: 116 PNVFDAKVTVDGLRAVKPMR-EWQLSDNAAYMHYCPNETIDGIAIDETPDFGADV---VV 171 NV A + D A P R +W+LS NAAY+H C NETIDG+ TP+ AD + Sbjct: 122 VNV--AASSADRKFASIPARADWKLSRNAAYVHICSNETIDGVEYQYTPEVAADTDGAPL 179 Query: 172 AADFSSTILSRPIDVSRYGVIYAGAQKNIGPAGLTIVIVREDLLGKANIACPSILDYSIL 231 AD SS ILSR +DVS+YGVIY GAQKNIGPAG+TIVIVREDLLG A CPS D+ I+ Sbjct: 180 VADMSSHILSREVDVSKYGVIYGGAQKNIGPAGVTIVIVREDLLGHALPFCPSAFDWKIV 239 Query: 232 NDNGSMFNTPPTFAWYLSGLVFKWLKANGGVAEMDKINQQKAELLYGVIDNSDFYRNDVA 291 DN SM+NTPPT+A Y++GLVF+W+K GGVA ++ N KA LLYG +D++DFY N +A Sbjct: 240 ADNDSMYNTPPTYAIYIAGLVFQWIKRQGGVAALEARNIAKARLLYGYLDSTDFYSNRIA 299 Query: 292 KANRSRMNVPFQLADSALDKLFLEESFAAGLHALKGHRVVGGMRASIYNAMPLEGVKALT 351 RSRMNVPF L D AL+ FL + GL LKGH+ VGGMRASIYNAMP+EGV+AL Sbjct: 300 ADCRSRMNVPFFLRDDALNDTFLAGAKERGLLQLKGHKSVGGMRASIYNAMPIEGVQALV 359 Query: 352 DFMVEFERRHG 362 D++ +FE++HG Sbjct: 360 DYLKDFEKQHG 370 Lambda K H 0.319 0.136 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 430 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 370 Length adjustment: 30 Effective length of query: 332 Effective length of database: 340 Effective search space: 112880 Effective search space used: 112880 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate HSERO_RS18435 HSERO_RS18435 (MFS transporter)
to HMM TIGR01364 (serC: phosphoserine transaminase (EC 2.6.1.52))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01364.hmm # target sequence database: /tmp/gapView.22967.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01364 [M=358] Accession: TIGR01364 Description: serC_1: phosphoserine transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.7e-161 520.8 0.0 8.7e-161 520.7 0.0 1.0 1 lcl|FitnessBrowser__HerbieS:HSERO_RS18435 HSERO_RS18435 MFS transporter Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS18435 HSERO_RS18435 MFS transporter # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 520.7 0.0 8.7e-161 8.7e-161 1 358 [] 2 369 .. 2 369 .. 0.97 Alignments for each domain: == domain 1 score: 520.7 bits; conditional E-value: 8.7e-161 TIGR01364 1 ivnFsaGPaalpeevlekaqkelldfnglglsvmeisHRskefekvveeaesdlreLlnipdnyevlf 68 ++nFsaGPa+lp+evl++a++e+ld++g+g+svme+sHR ke+++++e a d+r L+nip+ny+vlf lcl|FitnessBrowser__HerbieS:HSERO_RS18435 2 VYNFSAGPAVLPKEVLQQAADEMLDWHGSGMSVMEMSHRGKEYMSIIEAALADVRALMNIPSNYKVLF 69 59****************************************************************** PP TIGR01364 69 lqGGattqfaavplnllkekk........vadyivtGawskkalkeakkltkevkvvaseeekkyski 128 lqGGa + a +p+nl++ ++ vadyi+tG+ws+k++kea ++++ v+v+as++++k+ +i lcl|FitnessBrowser__HerbieS:HSERO_RS18435 70 LQGGAIAENAIIPMNLAALRSpagkhevgVADYINTGSWSTKSIKEAGRYCT-VNVAASSADRKFASI 136 *****************944445557788**********************9.*************** PP TIGR01364 129 pdeeelelkedaayvylcanetieGvefkelpevkk....aplvaDlssdilsrkidvskygliyaGa 192 p + +++l+ +aayv++c+neti+Gve++ +pev+ aplvaD+ss+ilsr++dvskyg+iy+Ga lcl|FitnessBrowser__HerbieS:HSERO_RS18435 137 PARADWKLSRNAAYVHICSNETIDGVEYQYTPEVAAdtdgAPLVADMSSHILSREVDVSKYGVIYGGA 204 ********************************998888899*************************** PP TIGR01364 193 qKniGpaGvtvvivrkdllerakkelpsvldYkilaendslyntpptfaiyvlglvlkwlkekGGvkk 260 qKniGpaGvt+vivr+dll++a +ps +d+ki+a+nds+yntppt+aiy++glv++w+k++GGv++ lcl|FitnessBrowser__HerbieS:HSERO_RS18435 205 QKNIGPAGVTIVIVREDLLGHALPFCPSAFDWKIVADNDSMYNTPPTYAIYIAGLVFQWIKRQGGVAA 272 ******************************************************************** PP TIGR01364 261 lekknqeKakllYeaidesegfyknkvekkaRslmnvvFtlkkeelekeFlkeaeekglvslkGhrsv 328 le++n +Ka+llY ++d++ +fy n++++++Rs+mnv+F l+++ l+++Fl+ a+e+gl++lkGh+sv lcl|FitnessBrowser__HerbieS:HSERO_RS18435 273 LEARNIAKARLLYGYLDST-DFYSNRIAADCRSRMNVPFFLRDDALNDTFLAGAKERGLLQLKGHKSV 339 *****************77.6*********************************************** PP TIGR01364 329 GGiRasiYnalpleevqaLvdfmkeFekkh 358 GG+RasiYna+p+e+vqaLvd++k+Fek+h lcl|FitnessBrowser__HerbieS:HSERO_RS18435 340 GGMRASIYNAMPIEGVQALVDYLKDFEKQH 369 ***************************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (358 nodes) Target sequences: 1 (370 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 7.63 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory