Align homoserine dehydrogenase (EC 1.1.1.3); aspartate kinase (EC 2.7.2.4) (characterized)
to candidate HSERO_RS10695 HSERO_RS10695 aspartate kinase
Query= BRENDA::Q9WZ17 (739 letters) >FitnessBrowser__HerbieS:HSERO_RS10695 Length = 417 Score = 285 bits (729), Expect = 3e-81 Identities = 164/414 (39%), Positives = 252/414 (60%), Gaps = 16/414 (3%) Query: 339 SVVVMKFGGAAISDVEKLEKVAEKIIKRKKSGVKPVVVLSAMGDTTDHLIELAKTIDENP 398 ++ V K+GG ++ +E+++ VA+++ K +G + VVV SAM T+ L+ +AK I P Sbjct: 2 ALYVHKYGGTSMGSIERIQNVAKRVAKWHDAGHQIVVVPSAMSGETNRLLGMAKEIMAQP 61 Query: 399 DPRELDLLLSTGEIQSVALMSIALRKRGYKAISFTGNQLKIITDKRYGSARIIDINTDII 458 D RELD+L STGE SVAL++IAL+ G +A+S+ G Q+ I TD + ARI I+ + Sbjct: 62 DGRELDMLASTGEQVSVALLAIALQALGKQAVSYAGWQVPIKTDSAFTKARIRSIDDAKV 121 Query: 459 SRYLKQDFIPVVAGFQGITETGDITTLGRGGSDLTAIALAYSLGADLCELYKDVDGVYTA 518 + L I ++ GFQG+ G+ITTLGRGGSD +A+A+A ++ A C +Y DVDGVYT Sbjct: 122 RKDLNAGKIVIITGFQGVDADGNITTLGRGGSDTSAVAVAAAIKAAECLIYTDVDGVYTT 181 Query: 519 DPRIVKDARVIKELSWEEMIELSRHGAQVLQARAAEFARKYGVKVLIKN---------AH 569 DPR+V +AR +K +++EEM+E++ G++VLQ R+ EFA Y + + + A Sbjct: 182 DPRVVSEARRLKTVTFEEMLEMASLGSKVLQIRSVEFAGNYKMPTRVLSSLTDPLTPLAE 241 Query: 570 KETRGTLI--WEGTKVENPIVRAVTFEDGMAKVVLKDVPDKPGVAARIMRTLSQMGVNID 627 + GTLI E +E + + F AK+ + VPD+PG+A +I+ ++ + +D Sbjct: 242 EAASGTLISFEEDKNMEQATITGIAFSRDEAKITVLGVPDRPGIAYQILGPVADANIEVD 301 Query: 628 MIIQGMKSGEYNTVAFIVPESQLGKLDIDLL----KTRSEAKEIIIEKGLAKVSIVGVNL 683 MIIQ F VP + K +++L K A I + ++KVS+VGV + Sbjct: 302 MIIQNQSVEGKTDFTFTVPRGEYAKA-VEVLNNSVKAHIGAAAINGDTKVSKVSVVGVGM 360 Query: 684 TSTPEISATLFETLANEGINIDMISASSSRISVIIDGKYVEDAVKAIHSRFELD 737 S I++ +F TL+ EG+NI MIS S +ISV+ID KY+E AV+A+H F+LD Sbjct: 361 RSHVGIASQMFRTLSEEGVNIQMISTSEIKISVLIDEKYMELAVRALHKAFDLD 414 Lambda K H 0.318 0.137 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 675 Number of extensions: 28 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 739 Length of database: 417 Length adjustment: 36 Effective length of query: 703 Effective length of database: 381 Effective search space: 267843 Effective search space used: 267843 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory