GapMind for Amino acid biosynthesis

 

Alignments for a candidate for trpD_1 in Herbaspirillum seropedicae SmR1

Align Anthranilate synthase component 2; AS; ASII; EC 4.1.3.27; Anthranilate synthase, GATase component; Anthranilate synthase, glutamine amidotransferase component (uncharacterized)
to candidate HSERO_RS11160 HSERO_RS11160 glutamine amidotransferase

Query= curated2:Q57690
         (197 letters)



>FitnessBrowser__HerbieS:HSERO_RS11160
          Length = 239

 Score = 53.5 bits (127), Expect = 3e-12
 Identities = 39/129 (30%), Positives = 58/129 (44%), Gaps = 15/129 (11%)

Query: 53  SPGPKTPKE-----AGNCIKIIQEVDIPILGVCLGHQCIVEAFGGEV-----GRAKRVMH 102
           SP   T KE         ++   E+D P+ G+C GHQ +  AFGGEV     GRA   MH
Sbjct: 64  SPAMVTDKEDWSERTAEWLREAAELDTPMFGICYGHQLLTHAFGGEVGYNPAGRAAGTMH 123

Query: 103 GKASLINHDGEGIFKDIPNPFYGGRYHSLIAKEVPKELKITAKS-LDDNYIMGVRHKKLP 161
            K      + E +   +P  F     H       P +  + A+S +D ++++  +H    
Sbjct: 124 VKTLECCREDE-LLGVLPPEFPAHMLHMQSVLRPPPDAIVMARSPMDPHHVIKHKHN--- 179

Query: 162 IEGVQFHPE 170
           +   QFHPE
Sbjct: 180 VYSTQFHPE 188


Lambda     K      H
   0.319    0.142    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 107
Number of extensions: 4
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 197
Length of database: 239
Length adjustment: 22
Effective length of query: 175
Effective length of database: 217
Effective search space:    37975
Effective search space used:    37975
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 45 (21.9 bits)

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory