Align Anthranilate phosphoribosyltransferase; EC 2.4.2.18 (characterized)
to candidate HSERO_RS19445 HSERO_RS19445 anthranilate phosphoribosyltransferase
Query= SwissProt::Q8PD71 (345 letters) >FitnessBrowser__HerbieS:HSERO_RS19445 Length = 345 Score = 470 bits (1210), Expect = e-137 Identities = 234/340 (68%), Positives = 279/340 (82%) Query: 1 MPITPQQALQRTIEHREIFHDEMVDLMRQIMRGEVSDAMVSAILTGLRVKKETIGEIAGA 60 MPITPQ+AL R IEHREIFHDEM+ L RQIM GE+S M++A+ GLRVKKE+IGEIA A Sbjct: 1 MPITPQEALLRCIEHREIFHDEMLTLFRQIMSGEMSPVMIAALTMGLRVKKESIGEIAAA 60 Query: 61 ATVMREFSRRVEVTDRRHMVDIVGTGGDGSHTFNISTCAMFVAAAGGAKVAKHGNRSVSS 120 A VMREF+ +V + D ++DIVGTGGDG+HTFNIST +MFVAAA GA+VAKHG RSVSS Sbjct: 61 AQVMREFATKVPMADTSRLLDIVGTGGDGAHTFNISTASMFVAAAAGARVAKHGGRSVSS 120 Query: 121 KSGSADALEALGAVIELQPEQVAASLAQTGIGFMYAPVHHPAMKVVAPVRREMGVRTIFN 180 SGSAD LEALGA I LQPEQVA S+AQTGIGFM+AP HH AMK APVR+E+GVRTIFN Sbjct: 121 SSGSADVLEALGADINLQPEQVAQSIAQTGIGFMFAPNHHAAMKHAAPVRKELGVRTIFN 180 Query: 181 ILGPLTNPAGSPNILMGVFHPDLVGIQARVLQELGAERALVVWGRDGMDELSLGAGTLVG 240 ILGPLTNPAG+PNILMGVFHPDLVGIQ RVLQ LGA+ A+VVWGRD +DE++LG T+VG Sbjct: 181 ILGPLTNPAGAPNILMGVFHPDLVGIQVRVLQRLGAQHAIVVWGRDNLDEVTLGGATMVG 240 Query: 241 ELRDGQVHEYEVHPEDFGIAMSASRNLKVADAAESRAMLLQVLDNVPGPALDIVALNAGA 300 EL +G++ EYE+HPEDFG++M ASRNL+V++AAES+ + + L PGP DIV +NA Sbjct: 241 ELINGEIREYEIHPEDFGLSMFASRNLQVSNAAESKEKIFEALRGEPGPVHDIVVINAAT 300 Query: 301 ALYVAGVADSIADGIVRARQVLADGSARACLDAYVAFTQQ 340 ALY AGVA SIA+G+ AR +A G+ARA LD +V T+Q Sbjct: 301 ALYAAGVAPSIAEGLQTARATIASGAARAKLDQFVQVTRQ 340 Lambda K H 0.320 0.134 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 393 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 345 Length of database: 345 Length adjustment: 29 Effective length of query: 316 Effective length of database: 316 Effective search space: 99856 Effective search space used: 99856 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate HSERO_RS19445 HSERO_RS19445 (anthranilate phosphoribosyltransferase)
to HMM TIGR01245 (trpD: anthranilate phosphoribosyltransferase (EC 2.4.2.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01245.hmm # target sequence database: /tmp/gapView.31844.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01245 [M=330] Accession: TIGR01245 Description: trpD: anthranilate phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-129 417.6 2.2 2.3e-129 417.4 2.2 1.0 1 lcl|FitnessBrowser__HerbieS:HSERO_RS19445 HSERO_RS19445 anthranilate phosp Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS19445 HSERO_RS19445 anthranilate phosphoribosyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 417.4 2.2 2.3e-129 2.3e-129 3 329 .. 11 336 .. 9 337 .. 0.99 Alignments for each domain: == domain 1 score: 417.4 bits; conditional E-value: 2.3e-129 TIGR01245 3 klldnkdLseeeaeqlmkeimsgeasdaqiaAilvalrvkgeteeeiaglakalrekakkvekeesee 70 ++++++++ ++e+ +l+++imsge+s++ iaA+ + lrvk e++ eia++a+++re a+kv+ ++++ lcl|FitnessBrowser__HerbieS:HSERO_RS19445 11 RCIEHREIFHDEMLTLFRQIMSGEMSPVMIAALTMGLRVKKESIGEIAAAAQVMREFATKVPMADTSR 78 78999*************************************************************** PP TIGR01245 71 lvDivGTGGDglktiNiSTasalvaaaaGvkvaKhGnrsvssksGsaDvLealgvnlelspekvarsl 138 l+DivGTGGDg++t+NiSTas++vaaaaG++vaKhG rsvss+sGsaDvLealg+ ++l+pe+va+s+ lcl|FitnessBrowser__HerbieS:HSERO_RS19445 79 LLDIVGTGGDGAHTFNISTASMFVAAAAGARVAKHGGRSVSSSSGSADVLEALGADINLQPEQVAQSI 146 ******************************************************************** PP TIGR01245 139 eevgigFlfAPkyhpalkevapvRkeLgvrtvfNlLGPLlnParaklqvlGvyskdlvevlaevlknl 206 +++gigF+fAP++h a+k++apvRkeLgvrt+fN+LGPL+nPa a++ ++Gv+++dlv + ++vl++l lcl|FitnessBrowser__HerbieS:HSERO_RS19445 147 AQTGIGFMFAPNHHAAMKHAAPVRKELGVRTIFNILGPLTNPAGAPNILMGVFHPDLVGIQVRVLQRL 214 ******************************************************************** PP TIGR01245 207 gvkralvvhgedglDEisltgetkvaelkdgeieeytlspedfglkraeleelkggsaeenaellkev 274 g+++a+vv g+d+lDE++l g t v el +gei+ey+++pedfgl + ++l++++a+e+ e++ e+ lcl|FitnessBrowser__HerbieS:HSERO_RS19445 215 GAQHAIVVWGRDNLDEVTLGGATMVGELINGEIREYEIHPEDFGLSMFASRNLQVSNAAESKEKIFEA 282 ******************************************************************** PP TIGR01245 275 legkekkakrdivvlNaaaalyvagkakdlkegvelakeaiksgkalekleelva 329 l+g+ ++ +divv+Naa+aly+ag+a +++eg+++a+++i sg+a +kl+++v+ lcl|FitnessBrowser__HerbieS:HSERO_RS19445 283 LRGEP-GPVHDIVVINAATALYAAGVAPSIAEGLQTARATIASGAARAKLDQFVQ 336 ***99.999******************************************9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (330 nodes) Target sequences: 1 (345 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.76 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory