Align Aspartate--tRNA(Asp/Asn) ligase; EC 6.1.1.23; Aspartyl-tRNA synthetase; AspRS; Non-discriminating aspartyl-tRNA synthetase; ND-AspRS (uncharacterized)
to candidate 16970 b2890 lysine tRNA synthetase, constitutive (NCBI)
Query= curated2:B2V713 (602 letters) >FitnessBrowser__Keio:16970 Length = 505 Score = 126 bits (316), Expect = 2e-33 Identities = 108/350 (30%), Positives = 170/350 (48%), Gaps = 47/350 (13%) Query: 7 EFKRDYYCGDLNESNIGDE----------VRLLGWVDTVRDHGGVIFINLRDREGIVQVV 56 +F+RD+ L+ G E V + G + T R G F+ L+D G +Q+ Sbjct: 39 DFRRDHTSDQLHAEFDGKENEELEALNIEVAVAGRMMTRRIMGKASFVTLQDVGGRIQLY 98 Query: 57 FDPSKIGEELYNKA-KKLKSEYVIGVRGRVYRRPAGTENPKMKTGNIEVAGEELLILNTS 115 + E +YN+ KK ++G +G+++ K KTG + + EL +L + Sbjct: 99 VARDDLPEGVYNEQFKKWDLGDILGAKGKLF---------KTKTGELSIHCTELRLL--T 147 Query: 116 KAL-PFPIEDNIKVSEEVRLKYRYLDLRRPSMQRNII-LRHEVYQAVREFLAGNGFIEVE 173 KAL P P + + +E R + RYLDL RN +R ++ +R+F+ GF+EVE Sbjct: 148 KALRPLPDKFHGLQDQEARYRQRYLDLISNDESRNTFKVRSQILSGIRQFMVNRGFMEVE 207 Query: 174 TPMLTKSTPEGA--RDFLVPSRLEKGKFYALPQSPQLFKQILMVAGLERYFQIAKCFRDE 231 TPM+ + P GA R F+ Y L +P+L+ + L+V G ER F+I + FR+E Sbjct: 208 TPMM-QVIPGGAAARPFITHHNALDLDMY-LRIAPELYLKRLVVGGFERVFEINRNFRNE 265 Query: 232 DLRADRQPEFTQIDLEMSFVTEDDVMTLAESLIQYVYKKVLG----------IDIKIPFR 281 + PEFT ++L M++ D++ L ESL + + + +LG +D PF Sbjct: 266 GISVRHNPEFTMMELYMAYADYKDLIELTESLFRTLAQDILGKTEVTYGDVTLDFGKPFE 325 Query: 282 RMSYEEAINKY--GTDKPDLRYGLELIDITDLAKEVEFKVFNDVAKSGGL 329 +++ EAI KY TD DL D D AK + + V KS GL Sbjct: 326 KLTMREAIKKYRPETDMADL-------DNFDSAKAIAESIGIHVEKSWGL 368 Score = 50.8 bits (120), Expect = 1e-10 Identities = 29/86 (33%), Positives = 44/86 (51%), Gaps = 4/86 (4%) Query: 488 YDMVLNGEEIGGGSIRIHTPYIQEKVF----QLLNISEEEAKEKFGFLIEALSYGAPPHG 543 ++ + G EIG G ++ Q + F + ++EA + AL +G PP Sbjct: 414 FEFFIGGREIGNGFSELNDAEDQAQRFLDQVAAKDAGDDEAMFYDEDYVTALEHGLPPTA 473 Query: 544 GLAFGLDRILALMTGSESIRDVIAFP 569 GL G+DR++ L T S +IRDVI FP Sbjct: 474 GLGIGIDRMVMLFTNSHTIRDVILFP 499 Lambda K H 0.319 0.140 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 715 Number of extensions: 45 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 602 Length of database: 505 Length adjustment: 36 Effective length of query: 566 Effective length of database: 469 Effective search space: 265454 Effective search space used: 265454 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory