Align serine O-acetyltransferase (EC 2.3.1.30) (characterized)
to candidate 14596 b0459 maltose O-acetyltransferase (NCBI)
Query= BRENDA::A0A0H2UNY1 (205 letters) >FitnessBrowser__Keio:14596 Length = 183 Score = 43.1 bits (100), Expect = 3e-09 Identities = 42/154 (27%), Positives = 65/154 (42%), Gaps = 27/154 (17%) Query: 37 HRLSHFLWKHGF---KLLARMYSQFWRFWTQIEIHPGAQIDSGVFIDHGSGLV------- 86 HR +H L + ++LA ++ Q T+ I P + D G I G+ Sbjct: 33 HRYNHSLAEEHTLRQQILADLFGQV----TEAYIEPTFRCDYGYNIFLGNNFFANFDCVM 88 Query: 87 -------IGETAIVEKGVLLYHGV-----TLGGTGKDCGKRHPTVRKGALISAHAQVIGP 134 IG+ ++ GV +Y +G + GK T+ I A + Sbjct: 89 LDVCPIRIGDNCMLAPGVHIYTATHPIDPVARNSGAELGKP-VTIGNNVWIGGRAVINPG 147 Query: 135 VEIGENAKVGAAAVVVADVPSDVTVVGIPAKIVR 168 V IG+N V + AVV DVP +V V G PA+I++ Sbjct: 148 VTIGDNVVVASGAVVTKDVPDNVVVGGNPARIIK 181 Lambda K H 0.319 0.137 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 79 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 205 Length of database: 183 Length adjustment: 20 Effective length of query: 185 Effective length of database: 163 Effective search space: 30155 Effective search space used: 30155 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory