Align glutamine synthetase (EC 6.3.1.2) (characterized)
to candidate 15417 b1297 putative glutamine synthetase (EC 6.3.1.2) (VIMSS)
Query= BRENDA::O33342 (457 letters) >lcl|FitnessBrowser__Keio:15417 b1297 putative glutamine synthetase (EC 6.3.1.2) (VIMSS) Length = 472 Score = 163 bits (413), Expect = 1e-44 Identities = 133/440 (30%), Positives = 202/440 (45%), Gaps = 31/440 (7%) Query: 26 VIVAFTDMQGRLAGKRISGRHFVDDIATRGVECCSYLLAVDVDLNTVPGYAMASWDTGYG 85 V V TD+ G GKRI +G + + A+D+ N V + G G Sbjct: 40 VDVLLTDLNGCFRGKRIPVSSLKK--LEKGCYFPASVFAMDILGNVVE-------EAGLG 90 Query: 86 DMVMTPDLSTLRLIPWLPGTAL-------VIADLVWADGSEVAVSPRSILRRQLDRLKAR 138 + PD + + ++ L +A ++ +V DG+ V PR++L R +L+ R Sbjct: 91 QEMGEPDRTCVPVLGSLTPSAADPEFIGQMLLTMVDEDGAPFDVEPRNVLNRLWQQLRQR 150 Query: 139 GLVADVATELEFIVFDQPYRQAWASGYR------GLTPASDYNIDYAILASSRMEPLLRD 192 GL VA ELEF + D RQ A GY G + + Y++ + +L D Sbjct: 151 GLFPVVAVELEFYLLD---RQRDAEGYLQPPCAPGTDDRNTQSQVYSVDNLNHFADVLND 207 Query: 193 IRLGMAGAGLRFEAVKGECNMGQQEIG-FRYDEALVTCDNHAIYKNGAKEIADQHGKSLT 251 I + + E + GQ EI + D L CD+ K + +A++H T Sbjct: 208 IDELAQLQLIPADGAVAEASPGQFEINLYHTDNVLEACDDALALKRLVRLMAEKHKMHAT 267 Query: 252 FMAK-YDEREGNSCHIHVSLRGTDGSAVFADSNGPHGMSSMFRSFVAGQLATLREFTLCY 310 FMAK Y+E G+ HIH+S++ G V +D+ G S + + +AG + + Sbjct: 268 FMAKPYEEHAGSGMHIHISMQNNRGENVLSDAEGED--SPLLKKMLAGMIDLMPSSMALL 325 Query: 311 APTINSYKRFADSSFAPTALAWGLDNRTCALRV-VGHGQNIRVECRVPGGDVNQYLAVAA 369 AP +NSY+RF + PT +WG +NRT ALR+ G N RVE RV G D N YL +AA Sbjct: 326 APNVNSYRRFQPGMYVPTQASWGHNNRTVALRIPCGDRHNHRVEYRVAGADANPYLVMAA 385 Query: 370 LIAGGLYGIERGLQLPEPCVGNAYQGADVERLPVTLADAAVLFEDSALVREAFGEDVVAH 429 + AG L+G++ L L E GN + + P+ +DA F ++ +R GE Sbjct: 386 IFAGILHGLDNELPLQEEVEGNGLEQEGLP-FPIRQSDALGEFIENDHLRRYLGERFCHV 444 Query: 430 YLNNARVELAAFNAAVTDWE 449 Y EL F +T+ E Sbjct: 445 YHACKNDELLQFERLITETE 464 Lambda K H 0.321 0.137 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 520 Number of extensions: 27 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 457 Length of database: 472 Length adjustment: 33 Effective length of query: 424 Effective length of database: 439 Effective search space: 186136 Effective search space used: 186136 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory