Align beta-alanine-pyruvate transaminase (EC 2.6.1.18); alanine-glyoxylate transaminase (EC 2.6.1.44) (characterized)
to candidate 16752 b2662 4-aminobutyrate aminotransferase (NCBI)
Query= BRENDA::Q9SR86 (481 letters) >FitnessBrowser__Keio:16752 Length = 426 Score = 195 bits (495), Expect = 3e-54 Identities = 131/414 (31%), Positives = 206/414 (49%), Gaps = 14/414 (3%) Query: 60 STAEIIAKRREFLSPALFHFYNTPLNIVEAKMQYVFDENGRRYLDAFGGIATVSCGHCHP 119 S E++ +R + + + + P+ A+ V+D GR YLD GGIA ++ GH HP Sbjct: 3 SNKELMQRRSQAIPRGVGQIH--PIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHP 60 Query: 120 EVVNSVVKQLKLINHSTILYLNHT-ISDFAEALVSTLPGDL-KVVFFTNSGTEANELAMM 177 +VV +V QLK ++H+ L + + E + +PGD K +G+EA E A+ Sbjct: 61 KVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVK 120 Query: 178 MARLYTGCNDIVSLRNSYHGNAAATMGATAQSN---WKFNVVQSGVHHAINPDPYRGIFG 234 +AR T + ++ +YHG T+ T + N ++ V+ A+ P P GI Sbjct: 121 IARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISE 180 Query: 235 SDGEKYASDVHDLIQFGTSGQ-VAGFIGESIQGVGGIVELAPGYLPAAYDIVRKAGGVCI 293 D + +H + + + + +A + E +QG GG +P ++ + + G + I Sbjct: 181 DDA---IASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYASSPAFMQRLRALCDEHGIMLI 237 Query: 294 ADEVQSGFARTGTHFWGFQSHGVIPDIVTMAKGIGNGIPLGAVVTTPEIAGVLSRRSYFN 353 ADEVQSG RTGT F + GV PD+ T AK I G PL V E+ ++ Sbjct: 238 ADEVQSGAGRTGTLF-AMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGG 296 Query: 354 TFGGNPMCTAAGHAVLRVLHEEKLQENANLVGSHLKRRLTLLKNKYELIGDVRGRGLMLG 413 T+ GNP+ A VL+V +E L + AN +G LK L + K+ IGDVRG G M+ Sbjct: 297 TYAGNPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMIA 356 Query: 414 VEFVKDRDLKTPAKAETLHLMDQMKEMGVLVGKGGFYGNVFRITPPLCFTLSDA 467 +E +D D P T ++ + ++ G+++ G Y NV RI PL T+ DA Sbjct: 357 IELFEDGDHNKPDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPL--TIEDA 408 Lambda K H 0.320 0.136 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 505 Number of extensions: 32 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 481 Length of database: 426 Length adjustment: 33 Effective length of query: 448 Effective length of database: 393 Effective search space: 176064 Effective search space used: 176064 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory