Align acetolactate synthase (EC 2.2.1.6) (characterized)
to candidate 16478 b2373 hypothetical protein (NCBI)
Query= BRENDA::P9WG39 (547 letters) >lcl|FitnessBrowser__Keio:16478 b2373 hypothetical protein (NCBI) Length = 564 Score = 219 bits (559), Expect = 2e-61 Identities = 166/552 (30%), Positives = 270/552 (48%), Gaps = 22/552 (3%) Query: 1 MSTDTAPAQTMHAGRLIARRLKASGIDTVFTLSGGHLFSIYDGCREEGIRLIDTRHEQTA 60 MS MH +I LK + IDT++ + G + + + EGIR I RHEQ+A Sbjct: 1 MSDQLQMTDGMH---IIVEALKQNNIDTIYGVVGIPVTDMARHAQAEGIRYIGFRHEQSA 57 Query: 61 AFAAEGWSKVTRVPGVAALTAGPGITNGMSAMAAAQQNQSPLVVLGGRA--PALRWGMGS 118 +AA +T+ PG+ + PG NG++A+A A N P++++ G + + G Sbjct: 58 GYAAAASGFLTQKPGICLTVSAPGFLNGLTALANATVNGFPMIMISGSSDRAIVDLQQGD 117 Query: 119 LQEIDHVPFVAPVARFAATAQSAENAGLLVDQALQAAVSAPSGVAFVDFPMD-HAFSMSS 177 +E+D + P A+ A ++ G+ + +A++ +VS G ++D P + A +M Sbjct: 118 YEELDQMNAAKPYAKAAFRVNQPQDLGIALARAIRVSVSGRPGGVYLDLPANVLAATMEK 177 Query: 178 DNGRPGALTELPAGPT--PAGDALDRAAGLLSTAQRPVIMAGTNVWWGHAEAALLRLVEE 235 D + P P ++ A LL+ A+RP+I+ G + A+ L +E Sbjct: 178 DEALTTIVKVENPSPALLPCPKSVTSAISLLAKAERPLIILGKGAAYSQADEQLREFIES 237 Query: 236 RHIPVLMNGMARGVVPADHRLAFSRARSKALGEADVALIVGVPMDFRLGFGGV-FGSTTQ 294 IP L MA+G++ H L+ + ARS AL ADV ++VG +++ L G + + TQ Sbjct: 238 AQIPFLPMSMAKGILEDTHPLSAAAARSFALANADVVMLVGARLNWLLAHGKKGWAADTQ 297 Query: 295 LIVADRVEPAR-EHPRPVAAGLYGDLTAT----LSALAGSGGTDHQGWIEELATAETMAR 349 I D +EP + RP+A + GD+ ++ L+ L + T W + L + Sbjct: 298 FIQLD-IEPQEIDSNRPIAVPVVGDIASSMQGMLAELKQNTFTTPLVWRDILNIHKQQNA 356 Query: 350 DLEKAELVDDRIPLHPMRVYAELAALL--ERDALVVIDAGDFGSYAGRMIDSYLPGCWLD 407 +L D PL+ + + +L +D +V + + A +ID Y P LD Sbjct: 357 QKMHEKLSTDTQPLNYFNALSAVRDVLRENQDIYLVNEGANTLDNARNIIDMYKPRRRLD 416 Query: 408 SGPFGCLGSGPGYALAAKLARPQRQVVLLQGDGAFGFSGMEWDTLVRHNVAVVSVIGNNG 467 G +G +G G GYA+ A + VV ++GD AFGFSGME +T+ R+N+ V VI NNG Sbjct: 417 CGTWGVMGIGMGYAIGASVTSGS-PVVAIEGDSAFGFSGMEIETICRYNLPVTIVIFNNG 475 Query: 468 IWGLEKHPMEALYGYSVVA--ELRPGTRYDEVVRALGGHGELVSVPAELRPALERAFASG 525 G+ + L G + +L RYD+++ A G G V+ ELR AL S Sbjct: 476 --GIYRGDGVDLSGAGAPSPTDLLHHARYDKLMDAFRGVGYNVTTTDELRHALTTGIQSR 533 Query: 526 LPAVVNVLTDPS 537 P ++NV+ DP+ Sbjct: 534 KPTIINVVIDPA 545 Lambda K H 0.319 0.135 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 715 Number of extensions: 35 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 547 Length of database: 564 Length adjustment: 36 Effective length of query: 511 Effective length of database: 528 Effective search space: 269808 Effective search space used: 269808 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory