Align Acetate--CoA ligase CCL3; HlCCL3; 2-methylbutanoate--CoA ligase CCL4; 2-methylpropanoate--CoA ligase CCL4; Butanoate--CoA ligase CCL3; Hexanoate--CoA ligase CCL3; Isovalerate--CoA ligase CCL3; Pentanoate--CoA ligase CCL3; Propionate--CoA ligase CCL3; EC 6.2.1.1; EC 6.2.1.-; EC 6.2.1.17 (characterized)
to candidate 15820 b1701 short chain acyl-CoA synthetase, anaerobic (RefSeq)
Query= SwissProt::M4IS88 (568 letters) >FitnessBrowser__Keio:15820 Length = 548 Score = 132 bits (333), Expect = 3e-35 Identities = 106/356 (29%), Positives = 158/356 (44%), Gaps = 22/356 (6%) Query: 203 YTSGTTASPKGVVLSHRGAYLMSLSASVVWGINEGAIYLWTLPMFHCNGWCYTWGMAAFC 262 +TSGT PKGV+L+H + + +++ P+ H G+ + Sbjct: 195 FTSGTEGLPKGVMLTHNNILASERAYCARLNLTWQDVFMMPAPLGHATGFLHGVTAPFLI 254 Query: 263 GTNICLRQV-TAKGVYSAIAKYGVTHFCAAPVVLNTIVNAPPEEAIIPLPHLVHVMTAGA 321 G L + T + + + T A + ++N E+ L L + G Sbjct: 255 GARSVLLDIFTPDACLALLEQQRCTCMLGATPFVYDLLNVL-EKQPADLSALRFFLCGGT 313 Query: 322 APPPSVLFAMSEKGFKVAHTYGLSETYGPSTICAWKPEWDSLPPIKQARLNARQGVRYIA 381 P V ++G K+ YG +E+ + + P +R G Sbjct: 314 TIPKKVARECQQRGIKLLSVYGSTESSPHAVVNLDDP---------LSRFMHTDGYAAAG 364 Query: 382 LEGLDVVDTKTMKPVPADGTTMGEIVMRGNAVMKGYLKNPKANEESF-ADGWFHSGDLAV 440 +E V D + P +G E RG V GY P+ + +GW++SGDL Sbjct: 365 VEIKVVDDARKTLPPGCEG----EEASRGPNVFMGYFDEPELTARALDEEGWYYSGDLCR 420 Query: 441 KHPDGYIEIKDRSKDIIISGGENISSLEVENTLYLHPAVLEVSVVARPDERWGESPCAFV 500 GYI+I R KDII+ GGENISS EVE+ L HP + + VVA DER GE CA+V Sbjct: 421 MDEAGYIKITGRKKDIIVRGGENISSREVEDILLQHPKIHDACVVAMSDERLGERSCAYV 480 Query: 501 TLK-PNIDKSNEQVLAEDIIKFCKSKMPAYWVPKS-VVFGPLPKTATGKIQKHVLR 554 LK P+ S E+V+A F + ++ Y P+ VV LP+T +GKIQK +LR Sbjct: 481 VLKAPHHSLSLEEVVA----FFSRKRVAKYKYPEHIVVIEKLPRTTSGKIQKFLLR 532 Lambda K H 0.318 0.134 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 713 Number of extensions: 30 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 568 Length of database: 548 Length adjustment: 36 Effective length of query: 532 Effective length of database: 512 Effective search space: 272384 Effective search space used: 272384 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory