GapMind for Amino acid biosynthesis


Aligments for a candidate for trpD_1 in Escherichia coli BW25113

Align Bifunctional protein TrpGD; EC; EC (characterized)
to candidate 15383 b1263 bifunctional indole-3-glycerol-phosphate synthase/anthranilate phosphoribosyltransferase (NCBI)

Query= SwissProt::P00904
         (531 letters)

>lcl|FitnessBrowser__Keio:15383 b1263 bifunctional
           indole-3-glycerol-phosphate synthase/anthranilate
           phosphoribosyltransferase (NCBI)
          Length = 531

 Score = 1049 bits (2713), Expect = 0.0
 Identities = 531/531 (100%), Positives = 531/531 (100%)










Lambda     K      H
   0.318    0.134    0.388 

Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1119
Number of extensions: 21
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 531
Length of database: 531
Length adjustment: 35
Effective length of query: 496
Effective length of database: 496
Effective search space:   246016
Effective search space used:   246016
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

Align candidate 15383 b1263 (bifunctional indole-3-glycerol-phosphate synthase/anthranilate phosphoribosyltransferase (NCBI))
to HMM TIGR00566 (glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase)

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020);
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00566.hmm
# target sequence database:        /tmp/gapView.8471.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00566  [M=192]
Accession:   TIGR00566
Description: trpG_papA: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                       -----------
      2e-58  183.4   0.0    3.3e-58  182.7   0.0    1.4  1  lcl|FitnessBrowser__Keio:15383  b1263 bifunctional indole-3-glyc

Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Keio:15383  b1263 bifunctional indole-3-glycerol-phosphate synthase/anthranilate phosphoribosyltr
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  182.7   0.0   3.3e-58   3.3e-58       2     189 ..       4     186 ..       3     189 .. 0.95

  Alignments for each domain:
  == domain 1  score: 182.7 bits;  conditional E-value: 3.3e-58
                       TIGR00566   2 vllidnydsftynlvqlleelgaevvvkrndsltlqeieallplls..ivisPGPctPdeaaissleliehlaGklPil 78 
                                     +ll+dn dsftynl ++l  +g++vv+ rn+    + ie+l++  +  +++sPGP+ P ea+    el+ +l GklPi+
                                     8****************************************98877789*************98.9************* PP

                       TIGR00566  79 GvClGhqalaqafGadvvraekvkhGkvseiehngaavfaglfnPdalkatryhslvveaetldtllevtaleeeeiei 157
                                     G+ClGhqa+  a G+ v +a ++ hGk s+ieh+g+a+fagl+nP  l+++ryhslv    ++++ l+++a  +    +
                                     *********************************************..*********8..578****9999987665..* PP

                       TIGR00566 158 mairhrdlpleGvqfhPesilselGkellanf 189
                                     ma+rh +  + G qfhPesil+ +G++ll+  
  lcl|FitnessBrowser__Keio:15383 155 MAVRHDADRVCGFQFHPESILTTQGARLLEQT 186
                                     ****************************9875 PP

Internal pipeline statistics summary:
Query model(s):                            1  (192 nodes)
Target sequences:                          1  (531 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00
# Mc/sec: 11.64

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.



Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory