Align Anthranilate synthase component 2; AS; ASII; Anthranilate synthase, GATase component; Anthranilate synthase, glutamine amidotransferase component; EC 4.1.3.27 (characterized)
to candidate 17423 b3360 para-aminobenzoate synthase component II (NCBI)
Query= SwissProt::P20576 (201 letters) >lcl|FitnessBrowser__Keio:17423 b3360 para-aminobenzoate synthase component II (NCBI) Length = 187 Score = 268 bits (685), Expect = 5e-77 Identities = 129/192 (67%), Positives = 160/192 (83%), Gaps = 5/192 (2%) Query: 1 MLLMIDNYDSFTYNLVQYFGELKAEVKVVRNDELSVEQIEALAPERIVLSPGPCTPNEAG 60 M+L+IDNYDSFT+NL QYF EL A+V V RND L++ I+AL P++IV+SPGPCTP+EAG Sbjct: 1 MILLIDNYDSFTWNLYQYFCELGADVLVKRNDALTLADIDALKPQKIVISPGPCTPDEAG 60 Query: 61 VSLAVIERFAGKLPLLGVCLGHQSIGQAFGGEVVRARQVMHGKTSPIHHKDLGVFAGLAN 120 +SL VI +AG+LP+LGVCLGHQ++ QAFGG+VVRA +VMHGKTSPI H GVF GLAN Sbjct: 61 ISLDVIRHYAGRLPILGVCLGHQAMAQAFGGKVVRAAKVMHGKTSPITHNGEGVFRGLAN 120 Query: 121 PLTVTRYHSLVVKRESLPECLEVTAWTQHADGSLDEIMGVRHKTLNVEGVQFHPESILTE 180 PLTVTRYHSLVV+ +SLP C +VTAW++ EIMG+RH+ ++EGVQFHPESIL+E Sbjct: 121 PLTVTRYHSLVVEPDSLPACFDVTAWSE-----TREIMGIRHRQWDLEGVQFHPESILSE 175 Query: 181 QGHELLANFLRQ 192 QGH+LLANFL + Sbjct: 176 QGHQLLANFLHR 187 Lambda K H 0.319 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 172 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 201 Length of database: 187 Length adjustment: 20 Effective length of query: 181 Effective length of database: 167 Effective search space: 30227 Effective search space used: 30227 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 44 (21.6 bits)
Align candidate 17423 b3360 (para-aminobenzoate synthase component II (NCBI))
to HMM TIGR00566 (glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00566.hmm # target sequence database: /tmp/gapView.29136.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00566 [M=192] Accession: TIGR00566 Description: trpG_papA: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-103 329.1 0.0 4.8e-103 328.9 0.0 1.0 1 lcl|FitnessBrowser__Keio:17423 b3360 para-aminobenzoate synthas Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Keio:17423 b3360 para-aminobenzoate synthase component II (NCBI) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 328.9 0.0 4.8e-103 4.8e-103 1 192 [] 1 187 [] 1 187 [] 0.99 Alignments for each domain: == domain 1 score: 328.9 bits; conditional E-value: 4.8e-103 TIGR00566 1 mvllidnydsftynlvqlleelgaevvvkrndsltlqeieallpllsivisPGPctPdeaaissleliehlaGklPilG 79 m+llidnydsft+nl+q+++elga+v+vkrnd+ltl++i+al+p++ ivisPGPctPdea+is l++i+h+aG+lPilG lcl|FitnessBrowser__Keio:17423 1 MILLIDNYDSFTWNLYQYFCELGADVLVKRNDALTLADIDALKPQK-IVISPGPCTPDEAGIS-LDVIRHYAGRLPILG 77 79********************************************.****************.*************** PP TIGR00566 80 vClGhqalaqafGadvvraekvkhGkvseiehngaavfaglfnPdalkatryhslvveaetldtllevtaleeeeieim 158 vClGhqa+aqafG++vvra+kv+hGk+s i+hng++vf+gl+nP l++tryhslvve+++l+++++vta++e++ eim lcl|FitnessBrowser__Keio:17423 78 VCLGHQAMAQAFGGKVVRAAKVMHGKTSPITHNGEGVFRGLANP--LTVTRYHSLVVEPDSLPACFDVTAWSETR-EIM 153 ********************************************..****************************9.*** PP TIGR00566 159 airhrdlpleGvqfhPesilselGkellanflkr 192 +irhr+++leGvqfhPesilse+G++llanfl+r lcl|FitnessBrowser__Keio:17423 154 GIRHRQWDLEGVQFHPESILSEQGHQLLANFLHR 187 ********************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (192 nodes) Target sequences: 1 (187 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 4.89 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory