GapMind for Amino acid biosynthesis

 

Aligments for a candidate for gatA in Sphingomonas koreensis DSMZ 15582

Align Glutamyl-tRNA(Gln) amidotransferase subunit A; Glu-ADT subunit A; EC 6.3.5.7 (uncharacterized)
to candidate Ga0059261_3751 Ga0059261_3751 Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases

Query= curated2:Q72L58
         (471 letters)



>lcl|FitnessBrowser__Korea:Ga0059261_3751 Ga0059261_3751
           Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and
           related amidases
          Length = 518

 Score =  196 bits (499), Expect = 1e-54
 Identities = 168/491 (34%), Positives = 243/491 (49%), Gaps = 63/491 (12%)

Query: 1   MLAHEIRARVARGEVSPLEVAQAYLKRVQELDPGLGAFLS--LNERLLEEAEAVDPGL-- 56
           M A ++   + R  +S  EV  A+L+++  L+P   A +S    ERLL+ A A D     
Sbjct: 45  MDAVDLVTAIRRRVLSAREVMTAHLEQIDTLNPRFNAIVSRVAPERLLKAAAACDADAAA 104

Query: 57  -----PLAGLVVAVKDNIATRGLRTTAGSRLLENFVPPYEATAVARLKALGALVLGKTNL 111
                PL G   AVKD     G+  T G+ +L   VP  ++  V+R++  GA+ +GKTN+
Sbjct: 105 GRFHGPLHGFPHAVKDTAPAAGIPFTQGTPILRENVPTADSLVVSRMRNAGAIFIGKTNV 164

Query: 112 DEFGMGSSTEHSAFFPTKNPFDPDRVPGGSSGGSAAALAADLAPLALGSDTGGSVRQPAA 171
            EF +GS + +  F  T+N ++P    GGSSGG+A ALA  + PLA GSD GGS+R PA 
Sbjct: 165 PEFALGSHSFNPLFGVTRNAWNPAVSAGGSSGGAAVALALRMVPLADGSDFGGSLRNPAG 224

Query: 172 FCGVYGLKPTYGRV-SRFGLIAYASSLDQIGPMARSVRDLALLMDAVAGPDPLDATSL-D 229
           +  V+G +P++GRV S      +  +    GPMAR VRD+A L+   AGPD     SL +
Sbjct: 225 WNNVFGYRPSFGRVPSVPSSDVFGQTFAVSGPMARRVRDVAFLLSVQAGPDSRSPFSLTE 284

Query: 230 LPPRFQEALEGPLPPLR---LGVVREALAGNSPGVERALEEALKVFRELGLSVR--EVSW 284
            P RF  +L+      R   LG ++ ALA   PGV    E+AL  FR +G++V    +S 
Sbjct: 285 DPARFAGSLDREWKGRRVGWLGDLQGALA-TEPGVLDTCEKALSAFRSIGMAVEAARLSL 343

Query: 285 PSLPQALAAYYILAPAEASSNLARYDGTLYGRRAEGE---EVEGMMEATRALFGLEVKRR 341
            +      A  +   +  +  +  Y      R+ + E   EVEG ++ T    G +V   
Sbjct: 344 SAEEMWRTAVTLRHWSVGADLIGHYSDPAKRRQMKPEAIWEVEGYLKLT----GRQVA-- 397

Query: 342 VLVGTFVLSSGYYEAYYGRA---QAFRRRLKAEAQALFREVDLLLLPTTPHPAFPFG--- 395
                        EA  GRA   QAFR         LF   D L+LPT     FPF    
Sbjct: 398 -------------EASEGRARIYQAFR--------DLFDRYDFLILPTA--QVFPFDVEQ 434

Query: 396 ------ARRDPLAMYREDLYTVGANLTGLPALSFPAGFEG--HLPVGLQLLAPWGEDERL 447
                 A R+  + +R    T+ A + GLP L+ PAGF G   LP+G+Q++ P   D  +
Sbjct: 435 HWPRSIAGREMDSYHRWMEVTLPATMAGLPVLAAPAGFGGARRLPIGIQIIGPNHADLAV 494

Query: 448 LRAALAFEEAT 458
           L+   A+E A+
Sbjct: 495 LQVGHAYENAS 505


Lambda     K      H
   0.319    0.137    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 578
Number of extensions: 38
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 471
Length of database: 518
Length adjustment: 34
Effective length of query: 437
Effective length of database: 484
Effective search space:   211508
Effective search space used:   211508
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory