Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (characterized)
to candidate Ga0059261_0258 Ga0059261_0258 3-deoxy-D-arabinoheptulosonate-7-phosphate synthase (EC 2.5.1.54)
Query= BRENDA::P29976 (525 letters) >lcl|FitnessBrowser__Korea:Ga0059261_0258 Ga0059261_0258 3-deoxy-D-arabinoheptulosonate-7-phosphate synthase (EC 2.5.1.54) Length = 527 Score = 543 bits (1399), Expect = e-159 Identities = 265/446 (59%), Positives = 333/446 (74%), Gaps = 1/446 (0%) Query: 72 ALKWTPESWKLKKALQLPDYPNANELESVLKTIEAFPPIVFAGEARNLEERLADAAVGKA 131 A+ WTP+SWK +A QLP YP+ L + + +FPP+VFAGEAR L + LA A G+A Sbjct: 73 AMGWTPDSWKSAEARQLPIYPDTATLAAATTQLSSFPPLVFAGEARALTQELAKVARGEA 132 Query: 132 FLLQGGDCAESFKEFNATNIRDTFRVLLQMSIVLTFGGQVPVIKVGRMAGQFAKPRSDAF 191 FLLQGGDCAESF EF+ NIRDTFRV+LQM++VLTF ++P +KVGRMAGQFAKPRS Sbjct: 133 FLLQGGDCAESFAEFHPNNIRDTFRVILQMAVVLTFASKLPTVKVGRMAGQFAKPRSADT 192 Query: 192 EEKDGVKLPSYKGDNINGDTFDEKSRIPDPNRMIRAYTQSAATLNLLRAFATGGYAAIQR 251 E +GV+LPSY+GDN+N F ++RIPDP RMI+ Y+QSAATLNLLRAFA+GGYA + + Sbjct: 193 ETINGVELPSYRGDNVNDIAFTPEARIPDPQRMIQGYSQSAATLNLLRAFASGGYANLHQ 252 Query: 252 VTQWNLDFVEQSEQADRYQELANRVDEALGFMSACGLGTDH-PLMTTTDFYTSHECLLLP 310 V +W LDF+ +S + ++ ++A+R+ EAL FM ACG+ D P + TDFYTSHE LLLP Sbjct: 253 VHKWTLDFMGKSPWSAKFADVADRIGEALDFMQACGIDADSVPQLKGTDFYTSHEALLLP 312 Query: 311 YEQSLTRLDSTSGLYYDCSAHMVWCGERTRQLDGAHVEFLRGIANPLGIKVSNKMDPFEL 370 YEQ+LTR DS +G +YD SAHM+W G+RTR AHVEFLRGI NP+G+K ++P L Sbjct: 313 YEQALTRQDSLTGDWYDTSAHMLWIGDRTRFDGSAHVEFLRGIGNPIGMKCGPSLEPDAL 372 Query: 371 VKLVEILNPNNKPGRITVIVRMGAENMRVKLPHLIRAVRRSGQIVTWVCDPMHGNTIKAP 430 ++L++ LNP PGR+T+I R G + + LP L+RAV+R G V W CDPMHGN +KA Sbjct: 373 LRLLDTLNPARTPGRLTLITRYGHDKIEDGLPKLVRAVKREGHPVVWSCDPMHGNVVKAA 432 Query: 431 CGLKTRAFDSILAEVRAFLDVHEQEGSHAGGIHLEMTGQNVTECIGGSRTVTYDDLSSRY 490 G KTR F+ ILAEVR F VH EG++AGGIH EMTGQNVTEC GG V+ DL+ RY Sbjct: 433 NGYKTRPFERILAEVRGFFAVHRAEGTYAGGIHAEMTGQNVTECTGGMIDVSEHDLADRY 492 Query: 491 HTHCDPRLNASQSLELAFIVAERLRK 516 HTHCDPRLNA QSLELAF++AE L + Sbjct: 493 HTHCDPRLNAGQSLELAFLLAEMLNE 518 Lambda K H 0.318 0.132 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 723 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 525 Length of database: 527 Length adjustment: 35 Effective length of query: 490 Effective length of database: 492 Effective search space: 241080 Effective search space used: 241080 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
Align candidate Ga0059261_0258 Ga0059261_0258 (3-deoxy-D-arabinoheptulosonate-7-phosphate synthase (EC 2.5.1.54))
to HMM TIGR01358 (3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01358.hmm # target sequence database: /tmp/gapView.4681.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01358 [M=443] Accession: TIGR01358 Description: DAHP_synth_II: 3-deoxy-7-phosphoheptulonate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.7e-215 699.1 0.0 1.2e-214 698.8 0.0 1.0 1 lcl|FitnessBrowser__Korea:Ga0059261_0258 Ga0059261_0258 3-deoxy-D-arabino Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Korea:Ga0059261_0258 Ga0059261_0258 3-deoxy-D-arabinoheptulosonate-7-phosphate synthase (EC 2.5. # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 698.8 0.0 1.2e-214 1.2e-214 1 441 [. 76 518 .. 76 520 .. 0.99 Alignments for each domain: == domain 1 score: 698.8 bits; conditional E-value: 1.2e-214 TIGR01358 1 wsleswrskpaaqlPeyPdaealeavldtleslPPlvlageilklkeklaevakGeafllqgGdcaesf 69 w+++sw+s +a qlP yPd+++l a +++l+s+PPlv+age+++l ++la+va+GeafllqgGdcaesf lcl|FitnessBrowser__Korea:Ga0059261_0258 76 WTPDSWKSAEARQLPIYPDTATLAAATTQLSSFPPLVFAGEARALTQELAKVARGEAFLLQGGDCAESF 144 89******************************************************************* PP TIGR01358 70 keveadnirdklrvllqmavvltygaslPvvkvgriaGqyakPrsepieakdgvtlpsyrGdvingaaf 138 e++ +nird++rv+lqmavvlt++++lP vkvgr+aGq+akPrs+++e+ +gv+lpsyrGd++n af lcl|FitnessBrowser__Korea:Ga0059261_0258 145 AEFHPNNIRDTFRVILQMAVVLTFASKLPTVKVGRMAGQFAKPRSADTETINGVELPSYRGDNVNDIAF 213 ********************************************************************* PP TIGR01358 139 deaarvpdperlvrayaksaatlnllraltsgGyadlkkvheWnlefvkkspagaryeklaeeidealr 207 + +ar+pdp+r+++ y++saatlnllra++sgGya+l++vh+W+l+f++ksp +a++ ++a++i+eal lcl|FitnessBrowser__Korea:Ga0059261_0258 214 TPEARIPDPQRMIQGYSQSAATLNLLRAFASGGYANLHQVHKWTLDFMGKSPWSAKFADVADRIGEALD 282 ********************************************************************* PP TIGR01358 208 fmsavgvaeae..alkrvelytsheallldyeealtrvdskegqlfdlsahllWiGertrqldgahvef 274 fm+a+g++ ++ +lk +++ytshealll+ye+altr+ds +g+++d+sah+lWiG+rtr ahvef lcl|FitnessBrowser__Korea:Ga0059261_0258 283 FMQACGIDADSvpQLKGTDFYTSHEALLLPYEQALTRQDSLTGDWYDTSAHMLWIGDRTRFDGSAHVEF 351 *******9999899**********************************************9889***** PP TIGR01358 275 lrgvknPigikvgpsmeadellklievldPenePGrltlisrlGaekiaeklPelleavkaaGravvWv 343 lrg+ nPig+k+gps+e+d ll+l++ l+P + PGrltli+r G +ki + lP+l++avk++G+ vvW lcl|FitnessBrowser__Korea:Ga0059261_0258 352 LRGIGNPIGMKCGPSLEPDALLRLLDTLNPARTPGRLTLITRYGHDKIEDGLPKLVRAVKREGHPVVWS 420 ********************************************************************* PP TIGR01358 344 tdpmhGntleaasGyktrrfddilsevkeffevhkaeGthpGGvhleltGedvteclGGareitetdla 412 +dpmhGn ++aa+Gyktr f++il+ev++ff+vh+aeGt+ GG+h e+tG++vtec+GG +++e+dla lcl|FitnessBrowser__Korea:Ga0059261_0258 421 CDPMHGNVVKAANGYKTRPFERILAEVRGFFAVHRAEGTYAGGIHAEMTGQNVTECTGGMIDVSEHDLA 489 ********************************************************************* PP TIGR01358 413 sryetacdPrlnaeqslelaflvaeklre 441 +ry+t+cdPrlna qslelafl+ae+l+e lcl|FitnessBrowser__Korea:Ga0059261_0258 490 DRYHTHCDPRLNAGQSLELAFLLAEMLNE 518 **************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (443 nodes) Target sequences: 1 (527 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.03u 0.01s 00:00:00.04 Elapsed: 00:00:00.02 # Mc/sec: 8.99 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory