Align Cystathionine beta-synthase; Beta-thionase; Hemoprotein H-450; Serine sulfhydrase; EC 4.2.1.22 (characterized)
to candidate Ga0059261_3452 Ga0059261_3452 Cysteine synthase
Query= SwissProt::P32232 (561 letters) >FitnessBrowser__Korea:Ga0059261_3452 Length = 330 Score = 235 bits (600), Expect = 2e-66 Identities = 138/322 (42%), Positives = 188/322 (58%), Gaps = 4/322 (1%) Query: 72 KILPDILRKIGNTPMVRINRISKNAGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERAG 131 ++ D + IGNTP+VR+ S AG C++ KCEF N G SVKDR +L +++DAE G Sbjct: 2 QVANDTIALIGNTPLVRLKGPSTAAG--CDIYGKCEFANPGASVKDRAALFIVQDAEARG 59 Query: 132 TLKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTN 191 L PG TI+E T+GNTGIGLAL KGY+ IIVMPE S EK+D LRALGAE+V P Sbjct: 60 LLAPGGTIVEGTAGNTGIGLALVGNAKGYKTIIVMPETQSREKMDTLRALGAELVLVPA- 118 Query: 192 ARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDDTAEEILQQCDGKVDMLVAS 251 A + +P V + R+ E PN+ +Q+ N +N AH TAEEI Q +G++D + Sbjct: 119 APYSNPGHFVHTSRRIAEETPNAIWANQFDNIANRKAHIVGTAEEIWTQMEGRIDGFTCA 178 Query: 252 AGTGGTITGIARKLKEKCPGCKIIGVDPEGSILAEPEELNQTEQTAYEV-EGIGYDFIPT 310 AGTGGTI G+ LKEK I DP G+ L E + + V EGIG I Sbjct: 179 AGTGGTIAGVGLGLKEKDERVTIALSDPHGAALYEYYAHGELKAEGSSVAEGIGQGRITA 238 Query: 311 VLDRAVVDRWFKSNDDDSFAFARMLISQEGLLCGGSSGSAMAVAVKAAQELKEGQRCVVI 370 L+ A +D F+ +D++ + L+++EGL G SSG +A AV+ +EL G+R I Sbjct: 239 NLEGAPIDTQFRISDEEGLEWVERLLAEEGLCLGLSSGINVAGAVRLGRELGPGKRIATI 298 Query: 371 LPDSVRNYMSKFLSDKWMLQKG 392 L D+ Y+S + W+ KG Sbjct: 299 LCDTGFRYLSTLYNRDWLQSKG 320 Lambda K H 0.317 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 504 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 561 Length of database: 330 Length adjustment: 32 Effective length of query: 529 Effective length of database: 298 Effective search space: 157642 Effective search space used: 157642 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory