Align [CysO sulfur-carrier protein]-thiocarboxylate-dependent cysteine synthase (EC 2.5.1.113); O-phosphoserine sulfhydrylase (EC 2.5.1.65) (characterized)
to candidate Ga0059261_3644 Ga0059261_3644 cysteine synthase A
Query= BRENDA::P9WP53 (323 letters) >FitnessBrowser__Korea:Ga0059261_3644 Length = 306 Score = 194 bits (493), Expect = 2e-54 Identities = 119/307 (38%), Positives = 166/307 (54%), Gaps = 21/307 (6%) Query: 5 DSLLQALGNTPLVGLQRLSPRWDDGRDGPHVRLWAKLEDRNPTGSIKDRPAVRMIEQAEA 64 +++L+ +GNTP + +QRL P +W K E NP GSIKDR A+ M+E AEA Sbjct: 4 NTILETIGNTPHIRIQRLFPG---------AEVWVKSERSNPGGSIKDRIALSMVEAAEA 54 Query: 65 DGLLRPGATILEPTSGNTGISLAMAARLKGYRLICVMPENTSVERRQLLELYGAQIIFSA 124 DG L+PG TI+EPTSGNTG+ LAM A +KGY+LI VMPE+ S+ERR+L+ YGA + Sbjct: 55 DGSLKPGGTIVEPTSGNTGVGLAMVAAVKGYKLILVMPESMSIERRRLMLAYGATFDLTP 114 Query: 125 AEGGSNTAVATAKELAATNPSWVMLYQYGNPANTDSHYCGTGPELLADLPE--ITHFVAG 182 E G A+ A E+ + P M Q+ NPAN D H T E+L D + + + G Sbjct: 115 REKGMKGAIERAVEIVESTPGAWMPQQFENPANVDVHVKTTAQEILNDFADAPVDVIITG 174 Query: 183 LGTTGTLMGTGRFLREHVANVKIVAAEPRYG-------EGVYALRNMDEGFVPELYDPEI 235 +GT G + G L++ N+K+ A EP G + ++ + GFVP+ + Sbjct: 175 VGTGGHITGVAETLKKSWPNLKVYAVEPELSPVISGGQPGPHPIQGIGAGFVPKNLHTDA 234 Query: 236 LTARYSVGAVDAVRRTRELVHTEGIFAGISTGAVLHAALGVGAGALAAGERADIALVVAD 295 + V A +A R EG+ GIS+GA L AA+ L AG R + D Sbjct: 235 IDGAIQVDAGNAKDYARRAAREEGLLVGISSGATL-AAIAKKLPDLPAGSR--VLGFNYD 291 Query: 296 AGWKYLS 302 G +YLS Sbjct: 292 TGERYLS 298 Lambda K H 0.317 0.134 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 308 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 306 Length adjustment: 27 Effective length of query: 296 Effective length of database: 279 Effective search space: 82584 Effective search space used: 82584 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory