Align Phosphoglycerate dehydrogenase (EC 1.1.1.95) (characterized)
to candidate Ga0059261_0925 Ga0059261_0925 Phosphoglycerate dehydrogenase and related dehydrogenases
Query= reanno::SB2B:6938941 (308 letters) >FitnessBrowser__Korea:Ga0059261_0925 Length = 311 Score = 110 bits (275), Expect = 4e-29 Identities = 78/256 (30%), Positives = 122/256 (47%), Gaps = 13/256 (5%) Query: 60 LRWMQSTFAGVDLL-VKPRQRRDYLLTNVRGIFGPLMSEYLFGYLLARQREHDLYKSQQQ 118 L+W+ + +AG+D V + R +LTN GI ++EY +LA + D Sbjct: 62 LKWLSTIYAGIDAFDVDLLKTRGTILTNGVGINAIAVAEYAVMGMLAAAKRFDQVVRMAD 121 Query: 119 QKLW---LPGSYKTLQGSELLLLGTGSIAKHLAQTAKHFGMKVAGINRSAKATEGFDEVA 175 ++ W PG + + + L++G G+I + + FG+ V G+ RS G D Sbjct: 122 RREWPADAPGKVELFE-TRALIVGYGTIGRMIGDRLAAFGVDVTGVTRS-----GRDGTL 175 Query: 176 TLEALPTLMARADAIASILPSTEATRGILNENILARMKPDAVLFNLGRGDVLDLDALERQ 235 T + D + PST T ++ LA MKP A L N+ RGD++D AL Sbjct: 176 TPGQWRERLGDYDWLVLAAPSTGDTHALIGTAELAAMKPGAWLVNVARGDMVDQPALIEA 235 Query: 236 LRQHPQQQAVLDVFNQEPLPEDHPIWGLGNVIVTPHIAAPSFPE---QVAEIFSSNYHKF 292 L + A LDV + EPLP+DHP+W NVI + H++ S + + A +F N F Sbjct: 236 LEKRRIAGAFLDVVDPEPLPDDHPLWTTPNVIHSMHLSGRSQAKMFMRAAALFLENARAF 295 Query: 293 LLGETLSHRVNFERGY 308 G + + V+ + GY Sbjct: 296 AEGRPMKNVVDLDAGY 311 Lambda K H 0.320 0.137 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 276 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 311 Length adjustment: 27 Effective length of query: 281 Effective length of database: 284 Effective search space: 79804 Effective search space used: 79804 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory