GapMind for Amino acid biosynthesis

 

Aligments for a candidate for hisF in Sphingomonas koreensis DSMZ 15582

Align Imidazole glycerol phosphate synthase subunit HisF; IGP synthase cyclase subunit; IGP synthase subunit HisF; ImGP synthase subunit HisF; IGPS subunit HisF; EC 4.3.2.10 (characterized)
to candidate Ga0059261_1048 Ga0059261_1048 imidazoleglycerol phosphate synthase, cyclase subunit

Query= SwissProt::Q7SIB9
         (252 letters)



>lcl|FitnessBrowser__Korea:Ga0059261_1048 Ga0059261_1048
           imidazoleglycerol phosphate synthase, cyclase subunit
          Length = 255

 Score =  296 bits (758), Expect = 3e-85
 Identities = 156/252 (61%), Positives = 190/252 (75%), Gaps = 2/252 (0%)

Query: 1   MSLAKRIVPCLDVHAGRVVKGVNFVNLRDAGDPVEAARAYDEAGADELVFLDISATHEER 60
           M++  R++PCLDV  GRVVKGVNFVNLRDAGDPVE ARAYD AGADEL FLDI+A+HE R
Sbjct: 1   MTVRARVIPCLDVANGRVVKGVNFVNLRDAGDPVEQARAYDAAGADELCFLDITASHEAR 60

Query: 61  AILLDVVARVAERVFIPLTVGGGVRSLEDARKLLLSGADKVSVNSAAVRRPELIRELADH 120
             ++DVV R AE  F+PLTVGGGVRS EDAR LLL+GADKV+VNSAAV RPE++ E+A+ 
Sbjct: 61  GTIIDVVRRTAEVCFMPLTVGGGVRSAEDARALLLAGADKVAVNSAAVTRPEVVSEIAER 120

Query: 121 FGAQAVVLAIDARWRGDFP-EVHVAGGRVPTGLHAVEWAVKGVELGAGEILLTSMDRDGT 179
           FG+Q +V ++DAR   D   EV   GGR PTG+ AVE A+   +LGAGE+LLTSMDRDGT
Sbjct: 121 FGSQCIVASVDARRVADGRWEVFTHGGRKPTGIDAVEHALHLAKLGAGELLLTSMDRDGT 180

Query: 180 KEGYDLRLTRMVAEAVGVPVIASGGAGRMEHFLEAFQAG-AEAALAASVFHFGEIPIPKL 238
           ++GYDL L R +A+ V VPV+ASGG G ++H +   + G A A LAAS+FHFGE  I   
Sbjct: 181 RDGYDLDLIRTIADRVRVPVVASGGVGNLDHLVAGIRDGHASAVLAASIFHFGEASIVGA 240

Query: 239 KRYLAEKGVHVR 250
              LA  G+ VR
Sbjct: 241 HAALAAAGIPVR 252


Lambda     K      H
   0.321    0.138    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 264
Number of extensions: 12
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 252
Length of database: 255
Length adjustment: 24
Effective length of query: 228
Effective length of database: 231
Effective search space:    52668
Effective search space used:    52668
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 47 (22.7 bits)

Align candidate Ga0059261_1048 Ga0059261_1048 (imidazoleglycerol phosphate synthase, cyclase subunit)
to HMM TIGR00735 (hisF: imidazoleglycerol phosphate synthase, cyclase subunit)

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00735.hmm
# target sequence database:        /tmp/gapView.10839.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00735  [M=254]
Accession:   TIGR00735
Description: hisF: imidazoleglycerol phosphate synthase, cyclase subunit
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                 Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                 -----------
     6e-105  336.1   2.2     7e-105  335.8   2.2    1.0  1  lcl|FitnessBrowser__Korea:Ga0059261_1048  Ga0059261_1048 imidazoleglycerol


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Korea:Ga0059261_1048  Ga0059261_1048 imidazoleglycerol phosphate synthase, cyclase subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  335.8   2.2    7e-105    7e-105       4     254 .]       5     252 ..       2     252 .. 0.99

  Alignments for each domain:
  == domain 1  score: 335.8 bits;  conditional E-value: 7e-105
                                 TIGR00735   4 kriipCLdvkdgrvvkGvqfknlrdaGdpvelakkydeeGadelvflditassekretmlevvervaek 72 
                                                r+ipCLdv +grvvkGv+f nlrdaGdpve a++yd+ Gadel flditas+e r t+++vv+r+ae 
  lcl|FitnessBrowser__Korea:Ga0059261_1048   5 ARVIPCLDVANGRVVKGVNFVNLRDAGDPVEQARAYDAAGADELCFLDITASHEARGTIIDVVRRTAEV 73 
                                               79******************************************************************* PP

                                 TIGR00735  73 vfiPltvgGGiksiedvkkllraGadkvsintaavkapelikeladrfGsqaivvaidakreaeneeak 141
                                                f+PltvgGG++s ed++ ll aGadkv++n+aav++pe+++e+a+rfGsq+iv ++da+r+a+   + 
  lcl|FitnessBrowser__Korea:Ga0059261_1048  74 CFMPLTVGGGVRSAEDARALLLAGADKVAVNSAAVTRPEVVSEIAERFGSQCIVASVDARRVAD---GR 139
                                               *************************************************************997...69 PP

                                 TIGR00735 142 yevtikgGrestdldvvewakeveelGaGeilltsmdkdGtksGydlellkkvkeavkiPviasgGaGk 210
                                               +ev ++gGr+ t++d+ve a + ++lGaGe+lltsmd+dGt++Gydl l+++++++v++Pv+asgG+G+
  lcl|FitnessBrowser__Korea:Ga0059261_1048 140 WEVFTHGGRKPTGIDAVEHALHLAKLGAGELLLTSMDRDGTRDGYDLDLIRTIADRVRVPVVASGGVGN 208
                                               ********************************************************************* PP

                                 TIGR00735 211 aehleeaflkgkadaaLaasvfhkreltieevkeylaergvkvr 254
                                                +hl  ++ +g+a a+Laas+fh++e +i    + la+ g++vr
  lcl|FitnessBrowser__Korea:Ga0059261_1048 209 LDHLVAGIRDGHASAVLAASIFHFGEASIVGAHAALAAAGIPVR 252
                                               ******************************************98 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (254 nodes)
Target sequences:                          1  (255 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00
# Mc/sec: 7.23
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory