Align Histidinol-phosphatase [alternative form] (EC 3.1.3.15) (characterized)
to candidate Ga0059261_2035 Ga0059261_2035 histidinol-phosphatase, inositol monophosphatase family
Query= reanno::Korea:Ga0059261_2035 (260 letters) >FitnessBrowser__Korea:Ga0059261_2035 Length = 260 Score = 523 bits (1347), Expect = e-153 Identities = 260/260 (100%), Positives = 260/260 (100%) Query: 1 MPVSQADIDLAGRLADAAGAAIRPYFRAEHGLESKDDSSPVTLADKAAEAAMRRLIIAER 60 MPVSQADIDLAGRLADAAGAAIRPYFRAEHGLESKDDSSPVTLADKAAEAAMRRLIIAER Sbjct: 1 MPVSQADIDLAGRLADAAGAAIRPYFRAEHGLESKDDSSPVTLADKAAEAAMRRLIIAER 60 Query: 61 PMDAIIGEEEDDRPGTSGRIWVLDPIDGTRSFIVGRPIFGTLIALLEDGWPVLGIIDQPI 120 PMDAIIGEEEDDRPGTSGRIWVLDPIDGTRSFIVGRPIFGTLIALLEDGWPVLGIIDQPI Sbjct: 61 PMDAIIGEEEDDRPGTSGRIWVLDPIDGTRSFIVGRPIFGTLIALLEDGWPVLGIIDQPI 120 Query: 121 IKERWLGVTGRETLFNGKPARARTCRELSKALLATTSPALFTDGQLHAFEHVDAAVMSTV 180 IKERWLGVTGRETLFNGKPARARTCRELSKALLATTSPALFTDGQLHAFEHVDAAVMSTV Sbjct: 121 IKERWLGVTGRETLFNGKPARARTCRELSKALLATTSPALFTDGQLHAFEHVDAAVMSTV 180 Query: 181 LGGDCYNYGLVASGHLDIVIEAGLKLHDFAALVPVVEGAGGRMCDWQGDPLHAGSNGEVI 240 LGGDCYNYGLVASGHLDIVIEAGLKLHDFAALVPVVEGAGGRMCDWQGDPLHAGSNGEVI Sbjct: 181 LGGDCYNYGLVASGHLDIVIEAGLKLHDFAALVPVVEGAGGRMCDWQGDPLHAGSNGEVI 240 Query: 241 AAGDPARIEELVEALACQGH 260 AAGDPARIEELVEALACQGH Sbjct: 241 AAGDPARIEELVEALACQGH 260 Lambda K H 0.320 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 404 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 260 Length adjustment: 24 Effective length of query: 236 Effective length of database: 236 Effective search space: 55696 Effective search space used: 55696 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate Ga0059261_2035 Ga0059261_2035 (histidinol-phosphatase, inositol monophosphatase family)
to HMM TIGR02067 (hisN: histidinol-phosphatase (EC 3.1.3.15))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR02067.hmm # target sequence database: /tmp/gapView.26473.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02067 [M=252] Accession: TIGR02067 Description: his_9_HisN: histidinol-phosphatase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.9e-90 287.4 0.0 5.7e-90 287.2 0.0 1.0 1 lcl|FitnessBrowser__Korea:Ga0059261_2035 Ga0059261_2035 histidinol-phosph Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Korea:Ga0059261_2035 Ga0059261_2035 histidinol-phosphatase, inositol monophosphatase family # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 287.2 0.0 5.7e-90 5.7e-90 3 251 .. 9 255 .. 7 256 .. 0.96 Alignments for each domain: == domain 1 score: 287.2 bits; conditional E-value: 5.7e-90 TIGR02067 3 alalelaeaageailkyfrasdlkvdkksdktpVteADraaEeaireliaakfPddgilGEEfgeeeed 71 la +la+aag+ai +yfra++ ++k+d++pVt AD+aaE+a+r+li a++P d+i+GEE +++ ++ lcl|FitnessBrowser__Korea:Ga0059261_2035 9 DLAGRLADAAGAAIRPYFRAEH-GLESKDDSSPVTLADKAAEAAMRRLIIAERPMDAIIGEEEDDRPGT 76 57899***************66.566677778************************************* PP TIGR02067 72 aeyvWvlDPiDGTksFirGvPvwgtLiaLlekgkpvlGvisqPalgerfvaakgegallnggerelrvs 140 +++ WvlDPiDGT+sFi G P++gtLiaLle+g pvlG+i+qP+++er+++++g+++l ng +++r++ lcl|FitnessBrowser__Korea:Ga0059261_2035 77 SGRIWVLDPIDGTRSFIVGRPIFGTLIALLEDGWPVLGIIDQPIIKERWLGVTGRETLFNG--KPARAR 143 ***********************************************************98..8***** PP TIGR02067 141 evaklsdAvlvttspkaledeeereafeklrrkarltryggdcyayalvAsGrvdlvveaelspyDiaa 209 ++ +ls+A+l+ttsp al++ ++ +afe++ +++ t++ggdcy+y lvAsG+ d+v+ea+l+++D+aa lcl|FitnessBrowser__Korea:Ga0059261_2035 144 TCRELSKALLATTSP-ALFTDGQLHAFEHVDAAVMSTVLGGDCYNYGLVASGHLDIVIEAGLKLHDFAA 211 ***************.89999************************************************ PP TIGR02067 210 lipiieeAggvitdwkGkeae..eggeavaaanaalhdevlell 251 l+p++e+Agg + dw+G +++ ++ge++aa+++a +e++e+l lcl|FitnessBrowser__Korea:Ga0059261_2035 212 LVPVVEGAGGRMCDWQGDPLHagSNGEVIAAGDPARIEELVEAL 255 *******************997778999******9999999887 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (252 nodes) Target sequences: 1 (260 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 8.68 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory