Align LL-diaminopimelate aminotransferase (EC 2.6.1.83) (characterized)
to candidate Ga0059261_1288 Ga0059261_1288 Aspartate/tyrosine/aromatic aminotransferase
Query= BRENDA::Q2RK33 (390 letters) >FitnessBrowser__Korea:Ga0059261_1288 Length = 401 Score = 330 bits (847), Expect = 3e-95 Identities = 162/387 (41%), Positives = 235/387 (60%), Gaps = 3/387 (0%) Query: 2 QEARRIRELPPYLFARIEKKIAEARERGVDIISLGIGDPDMPTPSHVIDKLVAEAHNPEN 61 +E RI+ LPPY+ A + A AR G DII LG+G+PD+P P HVIDKL A P Sbjct: 3 EEFYRIKRLPPYVIAEVNGMRAAARAAGEDIIDLGMGNPDLPPPQHVIDKLCEVAQKPSA 62 Query: 62 HRYPTSEGLLAFRQAVADWYQRLYGVDLDPRREVVTLIGSKEGIAHISLCYVDPGDINLV 121 H Y S+G+ R+A A++Y R +GVD+DP EVV +GSKEG+A ++ PGD+ L Sbjct: 63 HGYSQSKGIPGLRRAQANYYGRRFGVDVDPESEVVVTMGSKEGLASLATAITAPGDVILA 122 Query: 122 PDPGYPVYNIGTLLAGGESYFMPLTAANGFLPDLGAIPSDVARRAKLMFINYPNNPTGAV 181 P+P YP++ G ++AG +P T + L + R ++ +NYP+NPT Sbjct: 123 PNPSYPIHTFGFIIAGATIRAVPTTPDEHYFESLERAMNFTVPRPSILVVNYPSNPTAET 182 Query: 182 ADLKFFQEVVEFARSYDLIVCHDAAYSEITYDGYRAPSFLQAPGAKEVGIEFNSVSKPYN 241 DL F++ +V +A+ + + D AYSE+ YDG S LQ GAK+V IEF S+SK Y+ Sbjct: 183 VDLAFYERLVAWAKENKVWIISDLAYSELYYDGKPTVSILQVKGAKDVAIEFTSLSKTYS 242 Query: 242 MTGWRLGWACGRADVIEALARIKSNIDSGAFQAVQYAGIAALTGPQEGLAEVRRVYQERR 301 M GWR+G+A G +I A+ R+KS +D GAF VQ A AAL GPQ+ + R++Y +RR Sbjct: 243 MAGWRIGFAVGNKQLIAAMTRVKSYLDYGAFTPVQAAACAALNGPQDIVEANRQLYHKRR 302 Query: 302 DIIVEGFNSLGWHLEKPKATFYVWAPVPRGYT---SASFAEMVLEKAGVIITPGNGYGNY 358 D++VE F GW + P A+ + WAP+P S F++ +L A V + PG GYG Sbjct: 303 DVLVESFGRAGWDIPAPPASMFAWAPLPPALAHLGSLEFSKQLLSHAKVAVAPGVGYGEN 362 Query: 359 GEGYFRIALTISKERMQEAIERLRRVL 385 GEG+ RIA+ +++R+++A +R+ L Sbjct: 363 GEGFVRIAMVENEQRLRQAARNVRKYL 389 Lambda K H 0.320 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 474 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 390 Length of database: 401 Length adjustment: 31 Effective length of query: 359 Effective length of database: 370 Effective search space: 132830 Effective search space used: 132830 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory