Align Cystathionine gamma-synthase; CGS; EC 2.5.1.48; O-succinylhomoserine (thiol)-lyase (uncharacterized)
to candidate Ga0059261_1388 Ga0059261_1388 cystathionine beta-lyase, bacterial
Query= curated2:Q1M0P5 (380 letters) >FitnessBrowser__Korea:Ga0059261_1388 Length = 411 Score = 204 bits (519), Expect = 4e-57 Identities = 129/383 (33%), Positives = 208/383 (54%), Gaps = 23/383 (6%) Query: 5 TKLIHGGISEDATTGAVSVPIYQTSTYRQDAIG----------HHKGYEYSRSGNPTRFA 54 T+++ G + T G V+ P+++ ST D + HH+ + Y R G+PT+++ Sbjct: 26 TRVVGAGRRPEWTQGIVNAPVWRASTILYDTVADLRASAGSDTHHRLF-YGRRGSPTQWS 84 Query: 55 LEELIADLEGGVKG-FAFASGLAGIHA-VFSLLQSGDHVLLGDDVYGGTFRLFNKVLVKN 112 L E + +LE G + F + SG+A + A + S+L GD +LL D VY T L + Sbjct: 85 LAEALTELEPGAEATFLYPSGVAAVSAALLSVLSPGDELLLADSVYDPTRSFATGFLKRF 144 Query: 113 GLSCTIIDTSDLSQIKKAIKPNTKALYLETPSNPLLKITDLAQCASVAKDHGLLTIVDNT 172 G+ D + I + I T+A+++ETP + ++ D+ + AK G++T++DNT Sbjct: 145 GVITRFYDPMIGAGIAELITDKTRAIFMETPGSLTFEVQDVPAIVAAAKARGVVTLLDNT 204 Query: 173 FATPYYQNPLLLGADIVVHSGTKYLGGHSDVVAGLVTTNNEALAQEIAFFQNAIGGVLGP 232 +ATP + G D+ + + TKY+ GHSDV+ G VT E Q++ A+G P Sbjct: 205 WATPLLFPAIEKGIDLSILACTKYVVGHSDVMLGSVTATAEHW-QQLRATSFALGQTASP 263 Query: 233 QDSWLLQRGIKTLGLRMQAHQKNALCVAEFLEKHPKVERVYYPGLPTHPNYELAKKQMRG 292 D+WL RG++T+ LR++ H + AL +A +LE P+V RV +P LP+ P ++L + +G Sbjct: 264 DDAWLGSRGLRTMALRLKQHGEAALEIARWLETRPEVARVLHPALPSCPGHDLFVRDFKG 323 Query: 293 FSGMLSFTLKNDSEA--TPFVESLKLFILGESLGGVESL-VGVPAFMTHACIPKTQREAA 349 +G+ SF L+ +EA ++SL+LF +G S GG ESL + V IP A Sbjct: 324 PAGLFSFVLRGGNEAGRAALIDSLELFGIGYSWGGFESLAIPVDPDRIRTVIPWQAEGPA 383 Query: 350 GIRDGLVRLSVGIEHEQDLLEDL 372 VRL +G+E DL+ DL Sbjct: 384 ------VRLQIGLEDPADLIADL 400 Lambda K H 0.318 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 357 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 380 Length of database: 411 Length adjustment: 31 Effective length of query: 349 Effective length of database: 380 Effective search space: 132620 Effective search space used: 132620 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory