Align Homoserine O-acetyltransferase; HAT; Homoserine transacetylase; HTA; EC 2.3.1.31 (characterized)
to candidate Ga0059261_2301 Ga0059261_2301 homoserine O-acetyltransferase (EC 2.3.1.31)
Query= SwissProt::Q9AAS1 (382 letters) >FitnessBrowser__Korea:Ga0059261_2301 Length = 371 Score = 493 bits (1270), Expect = e-144 Identities = 238/352 (67%), Positives = 282/352 (80%), Gaps = 3/352 (0%) Query: 22 PLRLDSGGVIEGLEIAYQTYGQLNADKSNAVLICHALTGDQHVASPHPTTGKPGWWQRLV 81 PLRLD G ++ +EIAY+TYG L D NA+LICHALTGDQHVASPHP TGKPGWW R+V Sbjct: 18 PLRLDGGVLLSPVEIAYETYGTLAPDGGNAILICHALTGDQHVASPHPVTGKPGWWTRMV 77 Query: 82 GPGKPLDPARHFIICSNVIGGCMGSTGPASINPATGKTYGLSFPVITIADMVRAQAMLVS 141 GPGKP+DP RHFI+C+NV+G CMGS+GPA++NPATG+ +G+ FPVITI DMVRAQAML+ Sbjct: 78 GPGKPVDPDRHFIVCANVLGSCMGSSGPATVNPATGRPWGMDFPVITIRDMVRAQAMLLD 137 Query: 142 ALGVETLFAVVGGSMGGMQVQQWAVDYPERMFSAVVLASASRHSAQNIAFHEVGRQAIMA 201 LGV L AVVGGSMGGMQ W +P+R+ + VV+AS +RHSAQNIAFHEVGRQA+MA Sbjct: 138 HLGVGRLKAVVGGSMGGMQALSWPATFPDRVDAVVVIASTARHSAQNIAFHEVGRQAVMA 197 Query: 202 DPDWRGGAYAEHGVRPEKGLAVARMAAHITYLSEPALQRKFGRELQ-RDGLSWGFDADFQ 260 DP W GGAY + G P GLAVARMAAHITYLSE L KFGR LQ R+ S+GFDADFQ Sbjct: 198 DPRWNGGAYYD-GDPPAAGLAVARMAAHITYLSEAGLTEKFGRRLQAREAKSFGFDADFQ 256 Query: 261 VESYLRHQGSSFVDRFDANSYLYITRAMDYFDIAASHGGVLAKAFTRARNVRFCVLSFSS 320 +ESYLRHQG SFVDRFDAN+YLYITRAMDYFD+A HGG+LA AF R RFC++SF + Sbjct: 257 IESYLRHQGLSFVDRFDANAYLYITRAMDYFDLAEEHGGLLANAFRETR-ARFCLVSFDT 315 Query: 321 DWLYPTAENRHLVRALTAAGARAAFAEIESDKGHDAFLLDEPVMDAALEGFL 372 DWLYPT ++R +V AL AAGA +F E+ S GHDAFLL+ P ++ ++GFL Sbjct: 316 DWLYPTRDSRAIVHALNAAGAPVSFVELSSPFGHDAFLLEAPELNRVVDGFL 367 Lambda K H 0.321 0.135 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 540 Number of extensions: 27 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 371 Length adjustment: 30 Effective length of query: 352 Effective length of database: 341 Effective search space: 120032 Effective search space used: 120032 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
Align candidate Ga0059261_2301 Ga0059261_2301 (homoserine O-acetyltransferase (EC 2.3.1.31))
to HMM TIGR01392 (metX: homoserine O-acetyltransferase (EC 2.3.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01392.hmm # target sequence database: /tmp/gapView.11308.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01392 [M=351] Accession: TIGR01392 Description: homoserO_Ac_trn: homoserine O-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-145 469.3 0.0 4.4e-145 469.1 0.0 1.0 1 lcl|FitnessBrowser__Korea:Ga0059261_2301 Ga0059261_2301 homoserine O-acet Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Korea:Ga0059261_2301 Ga0059261_2301 homoserine O-acetyltransferase (EC 2.3.1.31) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 469.1 0.0 4.4e-145 4.4e-145 4 350 .. 18 367 .. 16 368 .. 0.98 Alignments for each domain: == domain 1 score: 469.1 bits; conditional E-value: 4.4e-145 TIGR01392 4 eltlesGevlsevevayktyGtlnaerdNavlvcHaltgsahvagkadeedk.GWWdellGpgraldts 71 +l l+ G ls ve+ay+tyGtl+ ++ Na+l+cHaltg++hva+ + + k GWW++++Gpg+++d++ lcl|FitnessBrowser__Korea:Ga0059261_2301 18 PLRLDGGVLLSPVEIAYETYGTLAPDGGNAILICHALTGDQHVASPHPVTGKpGWWTRMVGPGKPVDPD 86 68999***************************************999877667**************** PP TIGR01392 72 ryfvvclNvlGsckGstgPlsinpetgkpygaefPlvtirDlvkaqkalldsLgveklaavvGgSlGGm 140 r+f+vc+NvlGsc Gs+gP+++np+tg+p+g +fP++tirD+v+aq++lld+Lgv +l+avvGgS+GGm lcl|FitnessBrowser__Korea:Ga0059261_2301 87 RHFIVCANVLGSCMGSSGPATVNPATGRPWGMDFPVITIRDMVRAQAMLLDHLGVGRLKAVVGGSMGGM 155 ********************************************************************* PP TIGR01392 141 qalewalsypervkkivvlatsarasaqaiafnevqrqailsDpeyndGeyaeeeqPekGLalARmlal 209 qal w ++ p+rv+++vv+a++ar+saq+iaf+ev rqa+++Dp +n+G y++ + P++GLa+ARm a+ lcl|FitnessBrowser__Korea:Ga0059261_2301 156 QALSWPATFPDRVDAVVVIASTARHSAQNIAFHEVGRQAVMADPRWNGGAYYDGDPPAAGLAVARMAAH 224 ********************************************************************* PP TIGR01392 210 ltYrseesleerfgreakseeslassleeefsvesylryqgkkfverFdAnsYllltkaldthdlargr 278 +tY+se+ l e+fgr+ +++e+ ++ ++++f++esylr+qg +fv+rFdAn+Yl++t+a+d++dla+++ lcl|FitnessBrowser__Korea:Ga0059261_2301 225 ITYLSEAGLTEKFGRRLQAREAKSFGFDADFQIESYLRHQGLSFVDRFDANAYLYITRAMDYFDLAEEH 293 ********************************************************************* PP TIGR01392 279 rdslkealkkikapvlvvgiesDllftleeqeelakalkaakle..yaeieseeGHDaFllekekveel 345 + l++a+++++a++++v++++D+l+++++++ +++al+aa++ ++e++s+ GHDaFlle+ +++++ lcl|FitnessBrowser__Korea:Ga0059261_2301 294 GGLLANAFRETRARFCLVSFDTDWLYPTRDSRAIVHALNAAGAPvsFVELSSPFGHDAFLLEAPELNRV 362 *****************************************99888*********************** PP TIGR01392 346 irefl 350 ++ fl lcl|FitnessBrowser__Korea:Ga0059261_2301 363 VDGFL 367 *9997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (371 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 8.98 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory