Align Methionine synthase component, B12 binding and B12-binding cap domains (EC:2.1.1.13) (characterized)
to candidate Ga0059261_0990 Ga0059261_0990 methionine synthase (B12-dependent) (EC 2.1.1.13)
Query= reanno::Phaeo:GFF1319 (233 letters) >FitnessBrowser__Korea:Ga0059261_0990 Length = 865 Score = 110 bits (276), Expect = 7e-29 Identities = 63/172 (36%), Positives = 100/172 (58%), Gaps = 5/172 (2%) Query: 26 LYDGLKEEIEESVNILLERGWAPYKVLTEALVGGMTIVGADFRDGILFVPEVLLAANAMK 85 L G+ + + E ++ P +V+ L+ GM +VG F G +F+P+V+ +A MK Sbjct: 316 LVKGIDQYVVEDTEECRQKADRPIEVIEGPLMDGMNVVGDLFGSGKMFLPQVVKSARVMK 375 Query: 86 GGMAILKPLLA---ETGAPRMGSMVIGTVKGDIHDIGKNLVSMMMEGAGFEVVDIGINNP 142 +A L P + E GA G +V+ TVKGD+HDIGKN+V ++++ GFEVVD+G+ P Sbjct: 376 KAVAHLLPYIEAAKEPGAKGKGKVVMATVKGDVHDIGKNIVGVVLQCNGFEVVDLGVMVP 435 Query: 143 VENYLEALEEHQPDILGMSALLTTTMPYMKVVIDTMIEQGKRDDYIVLVGGA 194 LEA E+ D++G+S L+T ++ M V + M + R +L+GGA Sbjct: 436 WSKILEAANENDADMIGLSGLITPSLDEMVTVAEEM--KRARMTMPLLIGGA 485 Lambda K H 0.318 0.138 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 455 Number of extensions: 30 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 233 Length of database: 865 Length adjustment: 32 Effective length of query: 201 Effective length of database: 833 Effective search space: 167433 Effective search space used: 167433 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory