GapMind for Amino acid biosynthesis

 

Alignments for a candidate for thrB in Sphingomonas koreensis DSMZ 15582

Align Homoserine kinase; HK; HSK; EC 2.7.1.39 (uncharacterized)
to candidate Ga0059261_3253 Ga0059261_3253 homoserine kinase (EC 2.7.1.39)

Query= curated2:O69015
         (320 letters)



>FitnessBrowser__Korea:Ga0059261_3253
          Length = 319

 Score =  305 bits (780), Expect = 1e-87
 Identities = 162/312 (51%), Positives = 206/312 (66%), Gaps = 4/312 (1%)

Query: 1   MAVYTSVSDEEVSSFLDLYPDSGRLLSIKGITEGVENSNYLITTDVRSYILTLYEKRVNP 60
           MAVYT VS E ++ FL  Y D G L+S KGI EGVENSNYL+ T    +ILTLYEKRV  
Sbjct: 1   MAVYTQVSAEALAGFLARY-DVGELVSAKGIAEGVENSNYLVETTRDRFILTLYEKRVEA 59

Query: 61  EELPFFMALTDHLAAENLPVPKAWKSRDGKQIQTLAGRPACLIEFLQGRWTPTPNAEQTR 120
            +LP+FM L DHLAA+ LPVP A K R G +IQ L GRPACLI+FL G     P   Q R
Sbjct: 60  ADLPYFMGLLDHLAAKGLPVPPAIKDRGGVEIQELNGRPACLIKFLSGISLSHPTPAQAR 119

Query: 121 ATGEMLGKMHKSLTHFSENRKNSLDLENWHILAEKCGFEAMNQIEAHMGDEVKKELDYLD 180
           A GE + +MH+++  F  +R NS+ ++ W  L EKCG  +++QI   + D++   +  + 
Sbjct: 120 AAGEAMAQMHRAVADFPLDRPNSMGVDTWQPLFEKCG-HSLDQIVPGLYDDLGFAIARVV 178

Query: 181 KFWPK-DLPRSVIHADLFPDNVLFEGDSLKGVIDFYFACTEVRAWDLAITYSAWCFDQED 239
             W + D  R  IHADLFPDNVL  GD + G+IDFYFACT++R +DLA+ +SAW FD   
Sbjct: 179 PAWTRNDFDRCAIHADLFPDNVLMRGDQVTGLIDFYFACTDIRVYDLAVMHSAWSFDAHG 238

Query: 240 -HFLADHAKALIKGYHQSFALTEEERAAFIVLLRGAALRFLLTRAWDWVNTPPDALVVPK 298
            ++      ALI GY  SF LTE ERAAF  L  GA +RF L+RAWDW+NTP DALV+ K
Sbjct: 239 RNYDPAVGDALIAGYEASFPLTEVERAAFPTLAAGACIRFSLSRAWDWLNTPADALVMRK 298

Query: 299 DPRDFFKRLRFY 310
           DP  + +RL+ Y
Sbjct: 299 DPLAYVRRLKHY 310


Lambda     K      H
   0.321    0.137    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 322
Number of extensions: 19
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 320
Length of database: 319
Length adjustment: 28
Effective length of query: 292
Effective length of database: 291
Effective search space:    84972
Effective search space used:    84972
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 48 (23.1 bits)

Align candidate Ga0059261_3253 Ga0059261_3253 (homoserine kinase (EC 2.7.1.39))
to HMM TIGR00938 (thrB: homoserine kinase (EC 2.7.1.39))

Software error:

../bin/blast/fastacmd -i /tmp/list.2991.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.2991.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.