GapMind for Amino acid biosynthesis

 

Aligments for a candidate for ilvC in Sphingomonas koreensis DSMZ 15582

Align acetohydroxyacid isomeroreductase (EC 1.1.1.86) (characterized)
to candidate Ga0059261_0066 Ga0059261_0066 ketol-acid reductoisomerase (EC 1.1.1.86)

Query= metacyc::MONOMER-18814
         (338 letters)



>lcl|FitnessBrowser__Korea:Ga0059261_0066 Ga0059261_0066 ketol-acid
           reductoisomerase (EC 1.1.1.86)
          Length = 339

 Score =  455 bits (1171), Expect = e-133
 Identities = 221/339 (65%), Positives = 271/339 (79%), Gaps = 1/339 (0%)

Query: 1   MKVFYDKDADLSLIKGKNVTIIGYGSQGHAHALNLKDSGVN-VTVGLRKSGASWNKAANA 59
           M+V+YD+DADL+LI GK + I+GYGSQGHAHA NL+DSGV  V + LR+  A+  KA  A
Sbjct: 1   MRVYYDRDADLNLITGKKIAIVGYGSQGHAHAQNLRDSGVKEVAIALREGSATAKKAEAA 60

Query: 60  GLQVKEVAEAVKGADVVMILLPDEQIADVYKNEVHDNIKEGAALAFAHGFNVHYGAVIPR 119
           G +V    EA + ADV+MIL PDE  A +++N++  N+K G+A+AFAHG N+H+G +   
Sbjct: 61  GFKVLSNKEAAQWADVLMILAPDEHQAAIWENDLKGNMKPGSAIAFAHGLNIHFGLIEAP 120

Query: 120 ADLDVIMIAPKAPGHTVRATYTQGGGVPHLIAVHQNKSGAARDIALSYATANGGGRAGII 179
           AD+DVIMIAPK PGHTVR+ Y +GGGVP LIAVHQ+ SG A D+AL+YA+  GGGR+GII
Sbjct: 121 ADIDVIMIAPKGPGHTVRSEYVRGGGVPCLIAVHQDASGNAHDVALAYASGVGGGRSGII 180

Query: 180 ETNFREETETDLFGEQAVLCGGTVELIKAGFETLVEAGYAPEMAYFECLHELKLIVDLIY 239
           ETNFREE ETDLFGEQAVLCGG   L++AGFETLVEAGYAPEMAYFECLHELKLIVDL+Y
Sbjct: 181 ETNFREECETDLFGEQAVLCGGATALVQAGFETLVEAGYAPEMAYFECLHELKLIVDLMY 240

Query: 240 EGGIANMNYSISNNAEYGEYVTGPRVVTEETKKAMKQCLTDIQTGEYAKSFLLENKAGAP 299
           EGGIANM YSISN AEYG+  TGPR++TEETKK MK+ L DIQ+G + K F+L+N+AG P
Sbjct: 241 EGGIANMRYSISNTAEYGDIKTGPRIITEETKKEMKRVLADIQSGRFVKDFVLDNRAGQP 300

Query: 300 TLISRRRLTAEHQIEEVGAKLRAMMPWIAKNKMVDQSKN 338
            L + R     HQIE+VG++LRAMMPWI  NK+VD+ KN
Sbjct: 301 ELKASRIAAKRHQIEQVGSELRAMMPWIGANKLVDKEKN 339


Lambda     K      H
   0.316    0.133    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 456
Number of extensions: 21
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 338
Length of database: 339
Length adjustment: 28
Effective length of query: 310
Effective length of database: 311
Effective search space:    96410
Effective search space used:    96410
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 49 (23.5 bits)

Align candidate Ga0059261_0066 Ga0059261_0066 (ketol-acid reductoisomerase (EC 1.1.1.86))
to HMM TIGR00465 (ilvC: ketol-acid reductoisomerase (EC 1.1.1.86))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00465.hmm
# target sequence database:        /tmp/gapView.15022.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00465  [M=314]
Accession:   TIGR00465
Description: ilvC: ketol-acid reductoisomerase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                 Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                 -----------
   2.7e-135  436.3   0.8   3.2e-135  436.1   0.8    1.0  1  lcl|FitnessBrowser__Korea:Ga0059261_0066  Ga0059261_0066 ketol-acid reduct


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Korea:Ga0059261_0066  Ga0059261_0066 ketol-acid reductoisomerase (EC 1.1.1.86)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  436.1   0.8  3.2e-135  3.2e-135       2     312 ..      15     327 ..      14     329 .. 0.99

  Alignments for each domain:
  == domain 1  score: 436.1 bits;  conditional E-value: 3.2e-135
                                 TIGR00465   2 kgkkvaiiGyGsqGeaqalnlrdsgln.vivglrkeaaswkkAeedGfkvltveeaikkadlimiLlpD 69 
                                                gkk+ai+GyGsqG+a+a nlrdsg++ v ++lr+++a+ kkAe  Gfkvl+ +ea++ ad++miL pD
  lcl|FitnessBrowser__Korea:Ga0059261_0066  15 TGKKIAIVGYGSQGHAHAQNLRDSGVKeVAIALREGSATAKKAEAAGFKVLSNKEAAQWADVLMILAPD 83 
                                               79************************559**************************************** PP

                                 TIGR00465  70 evqkevyeaeikpllkegkallfsHGfnivfkqivipkdvdvvlvAPKgpGalvReeykegrGvpsliA 138
                                               e q + +e+++k ++k g+a+ f+HG ni+f  i++p+d+dv+++APKgpG++vR+ey +g Gvp liA
  lcl|FitnessBrowser__Korea:Ga0059261_0066  84 EHQAAIWENDLKGNMKPGSAIAFAHGLNIHFGLIEAPADIDVIMIAPKGPGHTVRSEYVRGGGVPCLIA 152
                                               ********************************************************************* PP

                                 TIGR00465 139 veqdvtgeakeiAlayAkaiGgaragvlettFkeEvesDLfGEqavLcGglealikaafdtLveaGyqp 207
                                               v+qd++g+a+++AlayA ++Gg+r g++et F+eE+e+DLfGEqavLcGg +al++a+f+tLveaGy+p
  lcl|FitnessBrowser__Korea:Ga0059261_0066 153 VHQDASGNAHDVALAYASGVGGGRSGIIETNFREECETDLFGEQAVLCGGATALVQAGFETLVEAGYAP 221
                                               ********************************************************************* PP

                                 TIGR00465 208 elAyfeivhelklivdllkekGlelmrdavsntAklgalelr.eilkeelkkemqkilkeiqnGefake 275
                                               e+Ayfe++helklivdl++e+G+++mr ++sntA++g+++++ +i++ee+kkem+ +l +iq+G+f k+
  lcl|FitnessBrowser__Korea:Ga0059261_0066 222 EMAYFECLHELKLIVDLMYEGGIANMRYSISNTAEYGDIKTGpRIITEETKKEMKRVLADIQSGRFVKD 290
                                               ********************************************************************* PP

                                 TIGR00465 276 walekeagkpafeearkkekeqeiekvGkelralvka 312
                                               ++l+++ag+p++++ r + k ++ie+vG+elra++++
  lcl|FitnessBrowser__Korea:Ga0059261_0066 291 FVLDNRAGQPELKASRIAAKRHQIEQVGSELRAMMPW 327
                                               ***********************************97 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (314 nodes)
Target sequences:                          1  (339 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 9.22
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory