GapMind for Amino acid biosynthesis

 

Aligments for a candidate for ilvE in Sphingomonas koreensis DSMZ 15582

Align Branched-chain amino acid aminotransferase (EC 2.6.1.42) (characterized)
to candidate Ga0059261_3811 Ga0059261_3811 branched-chain amino acid aminotransferase, group II

Query= reanno::Cup4G11:RR42_RS25890
         (363 letters)



>lcl|FitnessBrowser__Korea:Ga0059261_3811 Ga0059261_3811
           branched-chain amino acid aminotransferase, group II
          Length = 362

 Score =  462 bits (1188), Expect = e-135
 Identities = 220/354 (62%), Positives = 266/354 (75%), Gaps = 1/354 (0%)

Query: 7   FSLEPNPNALDAATRDALMRDPAFGRVFTDHMVTITWREGQGWQDAKVTARKPFSIDPAC 66
           F  E NPN + A+ R AL+ +P FG++FTDHM  + W + +GW DAKV AR P S+DPA 
Sbjct: 6   FEFEANPNPVPASERAALLENPGFGKLFTDHMAMVRWSDTKGWHDAKVVARGPLSLDPAT 65

Query: 67  SVLHYGQEIFEGMKAYRGADGAVTLFRPLENARRFQASAKRMAMPALPESLFLEAIEQLV 126
           +VLHY QEIFEG+KAYR  D    LFRPLENARRF+ SA+RMAMP LP+ LFL +IE LV
Sbjct: 66  AVLHYAQEIFEGLKAYRTGDEGTALFRPLENARRFRESAQRMAMPELPDDLFLGSIEALV 125

Query: 127 RIDQAWVPH-GSGSLYLRPFMFANEVFLGIKPASEFIFCVIACPVGPYFKGGDKAVSVWV 185
           + D+ W+P    GSLYLRPFMFA+EVFLG+KPASE+++ VIA P G YFKGG  AV++WV
Sbjct: 126 KADREWIPQIEGGSLYLRPFMFASEVFLGVKPASEYLYLVIASPAGAYFKGGAPAVTIWV 185

Query: 186 SENYTRAAPGGTGEAKCGGNYAGSLVAQNEATANGCDQVVFLDAAEHRWVEELGGMNIFF 245
           S++YTRAAPGGTG AKCGGNYA SLVAQ EA   GCDQVVFLDA E RWVEELGGMN+FF
Sbjct: 186 SDHYTRAAPGGTGAAKCGGNYASSLVAQAEAIREGCDQVVFLDAVERRWVEELGGMNLFF 245

Query: 246 VMDDGTLVTPPLSGSILPGITRASVIELAREMGMVVEERRYSYPEWEADAKSGRLAEAFV 305
           V DDG++VTPPL G+ILPGITR S++ LARE G+ V E  Y+  +W+ADA SG+L E F 
Sbjct: 246 VFDDGSMVTPPLGGTILPGITRESILTLAREQGITVREEPYAIDQWKADAGSGKLVETFA 305

Query: 306 CGTAATLVAIGEVRSARTRFAIGNGTAGNTVKVLRDRLVEIQRNQAAGPAGWVH 359
           CGTAA +  +G+V+S    F IG+G  G   + L+ RL  IQR QA    GWVH
Sbjct: 306 CGTAAVVTPVGKVKSRDGEFTIGSGGPGQVTEALKARLTAIQRGQAPDIHGWVH 359


Lambda     K      H
   0.321    0.135    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 497
Number of extensions: 21
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 363
Length of database: 362
Length adjustment: 29
Effective length of query: 334
Effective length of database: 333
Effective search space:   111222
Effective search space used:   111222
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 49 (23.5 bits)

Align candidate Ga0059261_3811 Ga0059261_3811 (branched-chain amino acid aminotransferase, group II)
to HMM TIGR01123 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01123.hmm
# target sequence database:        /tmp/gapView.20901.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01123  [M=313]
Accession:   TIGR01123
Description: ilvE_II: branched-chain amino acid aminotransferase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                 Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                 -----------
   9.6e-128  411.5   0.0   1.1e-127  411.3   0.0    1.0  1  lcl|FitnessBrowser__Korea:Ga0059261_3811  Ga0059261_3811 branched-chain am


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Korea:Ga0059261_3811  Ga0059261_3811 branched-chain amino acid aminotransferase, group II
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  411.3   0.0  1.1e-127  1.1e-127       1     311 [.      48     359 ..      48     361 .. 0.99

  Alignments for each domain:
  == domain 1  score: 411.3 bits;  conditional E-value: 1.1e-127
                                 TIGR01123   1 WdeaelaseaeleldegsavlhYgqevfeGlkayRtadGkillfRpdanakRlrrsaerlllPeleeel 69 
                                               W++a++++ ++l+ld+++avlhY+qe+feGlkayRt d    lfRp +na+R+r+sa+r+++Pel+++l
  lcl|FitnessBrowser__Korea:Ga0059261_3811  48 WHDAKVVARGPLSLDPATAVLHYAQEIFEGLKAYRTGDEGTALFRPLENARRFRESAQRMAMPELPDDL 116
                                               ********************************************************************* PP

                                 TIGR01123  70 flealkqlvkadkdwvpkakseasLYlRPfliatednlGvkaakeylflvlasPvGaYfkgglapvsif 138
                                               fl +++ lvkad++w+p+ + + sLYlRPf++a e  lGvk+a+eyl+lv+asP+GaYfkgg   v+i+
  lcl|FitnessBrowser__Korea:Ga0059261_3811 117 FLGSIEALVKADREWIPQIE-GGSLYLRPFMFASEVFLGVKPASEYLYLVIASPAGAYFKGGAPAVTIW 184
                                               *****************999.99********************************************** PP

                                 TIGR01123 139 veteyvRaapkGtGavkvgGnYaasllaqkkaaeqglddvvyldpvekkkieevGaaniflitkdgelv 207
                                               v+++y+Raap+GtGa+k+gGnYa+sl aq++a ++g+d+vv+ld+ve++ +ee+G++n+f++ +dg++v
  lcl|FitnessBrowser__Korea:Ga0059261_3811 185 VSDHYTRAAPGGTGAAKCGGNYASSLVAQAEAIREGCDQVVFLDAVERRWVEELGGMNLFFVFDDGSMV 253
                                               ********************************************************************* PP

                                 TIGR01123 208 ttplsesiLegvtresllelakdlgleveereiaidelkaaveaGei..vfacGtaavitPvgelkieg 274
                                               t+pl + iL+g+tres+l+la++ g++v+e+  aid++ka + +G++   facGtaav+tPvg++k  +
  lcl|FitnessBrowser__Korea:Ga0059261_3811 254 TPPLGGTILPGITRESILTLAREQGITVREEPYAIDQWKADAGSGKLveTFACGTAAVVTPVGKVKSRD 322
                                               *********************************************99888******************* PP

                                 TIGR01123 275 kevevkseevGevtkklrdeltdiqyGkledkegWiv 311
                                                e+++ s+ +G+vt++l+  lt iq+G++ d +gW+ 
  lcl|FitnessBrowser__Korea:Ga0059261_3811 323 GEFTIGSGGPGQVTEALKARLTAIQRGQAPDIHGWVH 359
                                               ***********************************96 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (313 nodes)
Target sequences:                          1  (362 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 8.08
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory