GapMind for Amino acid biosynthesis

 

Alignments for a candidate for argE in Klebsiella michiganensis M5al

Align Acetylornithine deacetylase; AO; Acetylornithinase; EC 3.5.1.16; N-acetylornithinase; NAO (uncharacterized)
to candidate BWI76_RS12865 BWI76_RS12865 acetylornithine deacetylase

Query= curated2:O68873
         (380 letters)



>FitnessBrowser__Koxy:BWI76_RS12865
          Length = 389

 Score =  199 bits (506), Expect = 1e-55
 Identities = 138/375 (36%), Positives = 196/375 (52%), Gaps = 19/375 (5%)

Query: 8   LRATLTELVAMDTTSFRPNVPLIDYAQARLEAAGFSAERQKFLDDAGVEKVNLVAVKGGS 67
           LR  L +L+A DTTS   N+ LI +    L A G ++  Q F DD G  K NL A  G S
Sbjct: 5   LREILGQLLAFDTTSRESNLALIAWIGDFLRARGVTS--QLFYDDEG-RKANLYARLGPS 61

Query: 68  GSGRAALALVGHSDCVPYDA-AWT-DALRLTEKDGRLYARGACDTKGFIACALHA--ALN 123
           G G   L+  GH+D VP D  AWT     LTE+DGR Y RG+ D KGFIAC L +  A  
Sbjct: 62  GPGGVMLS--GHTDVVPVDGQAWTVPPFALTERDGRYYGRGSADMKGFIACVLASLEAFL 119

Query: 124 AEQLKAPLMVVLTADEEVGLTGAKKLVE---AGLGRARHAIVGEPTRLIPVRANKGYCLA 180
           A  L+ PL +  + DEEVG  G + LV+   A   +    I+GEPT + PV  +KG    
Sbjct: 120 AAPLRMPLHLAFSYDEEVGCLGVRSLVDFLRASAEKPALCIIGEPTDMRPVYGHKGKLAV 179

Query: 181 EVEVRGKEGHSAYPDSGASAIFRAGRFLQRLEHLALTVLREDLDEGFQPPFTTVNVGVIQ 240
              V G   HSAY   G +AI  A + + RL+ L  +   + LD  F PP  T+ VG I+
Sbjct: 180 RCRVEGHACHSAYAPQGVNAISYAAKLIYRLDALGES-FSQHLDRRFSPPSGTLQVGTIR 238

Query: 241 GGKAKNVIPGACRFVVEWRPIPGQPPERVSQLL-ETIRQELV----RDEPAFEAQIRVVR 295
           GG+A N++P +C F  E R +PG  P+ V+  L +  R++L+    +     +   + + 
Sbjct: 239 GGEALNIVPQSCWFDFEIRYLPGTRPQAVTDALGDYAREQLLPAMRKVAQCSDIHFQTLS 298

Query: 296 TDRGVNTRADAEVVRFLAEASGNAP-ETVSFGTEAPQMTELGAEAVVFGPGDIRVAHQTG 354
              G+ +   +   R+LA+  G+    TV++GTE     E G   ++ GPG +   H+  
Sbjct: 299 HYPGLLSDPQSAFARWLAQWCGSDDFTTVAYGTEGGLFDEAGVATLICGPGSMAQGHRAD 358

Query: 355 EYVPVEDLVRCEAVL 369
           EY+ +    RC A+L
Sbjct: 359 EYISIPQTERCLAML 373


Lambda     K      H
   0.319    0.136    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 369
Number of extensions: 18
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 380
Length of database: 389
Length adjustment: 30
Effective length of query: 350
Effective length of database: 359
Effective search space:   125650
Effective search space used:   125650
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

Align candidate BWI76_RS12865 BWI76_RS12865 (acetylornithine deacetylase)
to HMM TIGR01892 (argE: acetylornithine deacetylase (ArgE) (EC 3.5.1.16))

Software error:

../bin/blast/fastacmd -i /tmp/list.5920.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.5920.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.