Align 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase (EC 2.2.1.10) (characterized)
to candidate BWI76_RS24640 BWI76_RS24640 aldolase
Query= BRENDA::Q57843 (273 letters) >FitnessBrowser__Koxy:BWI76_RS24640 Length = 295 Score = 133 bits (335), Expect = 4e-36 Identities = 82/256 (32%), Positives = 139/256 (54%), Gaps = 8/256 (3%) Query: 11 GKLVRLERIFNRESEKTVIVPMDHGVSNGPIKGLIDIRKTVNDVAEGGANAVLLHKGIVR 70 G RL RIFN +S +TV++ DHG GP GL I ++ + E + ++ +G++R Sbjct: 35 GMQSRLARIFNPQSNRTVMLAFDHGYFQGPTTGLERIDLSIAPLFEE-TDVLMCTRGVLR 93 Query: 71 HGHRGYGKDVGLIIHLSGGTAISPNPLKKVIVTTVEEAIRMGADAVSIHVNVGSDEDWEA 130 + +++ SGG +I + + +E+A+R+ AV+ V +GS+ + ++ Sbjct: 94 -SQVPAATNKPVVLRASGGNSILSELSNECVAVAMEDALRLNVCAVAAQVYIGSEHEHQS 152 Query: 131 YRDLGMIAETCEYWGMPLIAMMYPRGKHIQNERDPELVAHAARLGAELGADIVKTSYTGD 190 ++ + + +GMP++A+ G + RD + A+R+ AE+GA VKT + + Sbjct: 153 INNIIKLVDAGNRYGMPVLAVT---GVGKEMTRDARYFSLASRIAAEMGAQFVKTYFVEE 209 Query: 191 IDSFRDVVKGCPAPVVVAGGPKTNTDEEFLQMIKDAMEAGAAGVAVGRNIFQHDDVVGIT 250 F V CP P+V+AGG K ++E L+M A++ GA+GV +GRNIFQ + Sbjct: 210 --GFEKVTASCPVPIVIAGGKKL-PEQEALEMCWRAIDQGASGVDMGRNIFQSSAPRAML 266 Query: 251 RAVCKIVHENADVEEA 266 +AV K+VHEN EA Sbjct: 267 KAVKKVVHENLSAREA 282 Lambda K H 0.318 0.138 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 183 Number of extensions: 7 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 295 Length adjustment: 26 Effective length of query: 247 Effective length of database: 269 Effective search space: 66443 Effective search space used: 66443 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory