Align cysteine synthase (EC 2.5.1.47); L-3-cyanoalanine synthase (EC 4.4.1.9) (characterized)
to candidate BWI76_RS24205 BWI76_RS24205 cystathionine beta-synthase
Query= BRENDA::Q84IF9 (308 letters) >FitnessBrowser__Koxy:BWI76_RS24205 Length = 456 Score = 211 bits (537), Expect = 3e-59 Identities = 126/306 (41%), Positives = 179/306 (58%), Gaps = 13/306 (4%) Query: 6 NSITELIGDTPAVKLNRIVDEDSADVYLKLEFMNPGSSVKDRIALAMIEAAEKAGKLKPG 65 +S+++LIG TP ++L+++ D +++LKLE NPG S+KDR+AL+MI AE+ GKLKPG Sbjct: 5 HSVSDLIGHTPLLQLHKL-DTGPCNLFLKLENQNPGGSIKDRVALSMITQAEREGKLKPG 63 Query: 66 DTIVEPTSGNTGIGLAMVAAAKGYKAVLVMPDTMSLERRNLLRAYGAELVLTPGAQGMRG 125 TI+E T+GNTG+GLA++AA K Y+ +LV+PD MS E+ LRA GA++ LT + +G Sbjct: 64 GTIIEATAGNTGLGLALIAAQKNYRLILVVPDKMSREKIFHLRALGAQVQLT-RSDVNKG 122 Query: 126 PIAKAEELVRE-----HGYFMPQQFKNEANPEIHRLTTGKEIVEQMGDQLDAFVAGVGTG 180 A ++ R G F QF NEANP H TT EI +Q+ +DA V GVG+G Sbjct: 123 HPAYYQDYARRLADETPGAFYIDQFNNEANPLAHATTTAPEIFQQLEGDIDAIVVGVGSG 182 Query: 181 GTTTGAGKVLREAYPNIKIYAVEPADS----PVLSG--GKPGPHKIQGIGAGFVPDILDT 234 GT G E P + +PA S V +G G+ G ++GIG F+P + Sbjct: 183 GTLGGLQAWFAEHSPKTEFILADPAGSILADQVETGRYGETGSWLVEGIGEDFIPPLAHL 242 Query: 235 SIYDGVITVTTEEAFAAARRAAREEGILGGISSGAAIHAALKVAKELGKGKKVLAIIPSN 294 VT EAFA AR+ + EGIL G S+G + AAL+ + K+V+ + Sbjct: 243 EGVRSAYRVTDSEAFATARQLLQVEGILAGSSTGTLLTAALRYCRSQTSPKRVVTFACDS 302 Query: 295 GERYLS 300 G +YLS Sbjct: 303 GNKYLS 308 Lambda K H 0.314 0.134 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 282 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 456 Length adjustment: 30 Effective length of query: 278 Effective length of database: 426 Effective search space: 118428 Effective search space used: 118428 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory