Align ATP phosphoribosyltransferase (characterized)
to candidate BWI76_RS18920 BWI76_RS18920 ATP phosphoribosyltransferase
Query= CharProtDB::CH_024688 (299 letters) >FitnessBrowser__Koxy:BWI76_RS18920 Length = 299 Score = 555 bits (1430), Expect = e-163 Identities = 279/299 (93%), Positives = 293/299 (97%) Query: 1 MTDNTRLRIAMQKSGRLSDDSRELLARCGIKINLHTQRLIAMAENMPIDILRVRDDDIPG 60 M DN+RLRIA+QKSGRLS+DSRELL+RCGIK+NLHTQRLIA+AENMPIDILRVRDDDIPG Sbjct: 1 MLDNSRLRIAIQKSGRLSEDSRELLSRCGIKVNLHTQRLIALAENMPIDILRVRDDDIPG 60 Query: 61 LVMDGVVDLGIIGENVLEEELLNRRAQGEDPRYFTLRRLDFGGCRLSLATPVDEAWDGPL 120 L+MDGVVDLGIIGENVLEEELL+RRAQGEDPRYFTLRRLDFGGCRLSLATP DE WDGP Sbjct: 61 LIMDGVVDLGIIGENVLEEELLSRRAQGEDPRYFTLRRLDFGGCRLSLATPADEPWDGPA 120 Query: 121 SLNGKRIATSYPHLLKRYLDQKGISFKSCLLNGSVEVAPRAGLADAICDLVSTGATLEAN 180 LNGKRIATSYPHLLKRYLDQKGISFKSCLLNGSVEVAPRAGLADAICDLVSTGATLEAN Sbjct: 121 MLNGKRIATSYPHLLKRYLDQKGISFKSCLLNGSVEVAPRAGLADAICDLVSTGATLEAN 180 Query: 181 GLREVEVIYRSKACLIQRDGEMEESKQQLIDKLLTRIQGVIQARESKYIMMHAPTERLDE 240 GLREVEV++RSKACLIQRDGEM +SKQQLID+LLTRIQGVIQARESKYIMMHAPTERL+E Sbjct: 181 GLREVEVMFRSKACLIQRDGEMADSKQQLIDRLLTRIQGVIQARESKYIMMHAPTERLEE 240 Query: 241 VIALLPGAERPTILPLAGDQQRVAMHMVSSETLFWETMEKLKALGASSILVLPIEKMME 299 VIALLPGAERPTILPLAGD+QRVAMHMVSSETLFWETMEKLKALGASSILVLPIEKMME Sbjct: 241 VIALLPGAERPTILPLAGDKQRVAMHMVSSETLFWETMEKLKALGASSILVLPIEKMME 299 Lambda K H 0.320 0.137 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 426 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 299 Length adjustment: 27 Effective length of query: 272 Effective length of database: 272 Effective search space: 73984 Effective search space used: 73984 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate BWI76_RS18920 BWI76_RS18920 (ATP phosphoribosyltransferase)
to HMM TIGR00070 (hisG: ATP phosphoribosyltransferase (EC 2.4.2.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00070.hmm # target sequence database: /tmp/gapView.17904.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00070 [M=183] Accession: TIGR00070 Description: hisG: ATP phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-61 194.0 0.0 1.5e-61 193.5 0.0 1.2 1 lcl|FitnessBrowser__Koxy:BWI76_RS18920 BWI76_RS18920 ATP phosphoribosyl Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Koxy:BWI76_RS18920 BWI76_RS18920 ATP phosphoribosyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 193.5 0.0 1.5e-61 1.5e-61 1 183 [] 7 197 .. 7 197 .. 0.96 Alignments for each domain: == domain 1 score: 193.5 bits; conditional E-value: 1.5e-61 TIGR00070 1 lriAlp.KGrleeetlkllekaglklskkeerkliasaedeevevlllrakdiptyvekgaadlGitGkDl 70 lriA++ Grl+e++ +ll+++g+k++ ++ ++lia ae+ ++++l +r++dip + +g++dlGi+G+++ lcl|FitnessBrowser__Koxy:BWI76_RS18920 7 LRIAIQkSGRLSEDSRELLSRCGIKVNLHT-QRLIALAENMPIDILRVRDDDIPGLIMDGVVDLGIIGENV 76 89****99*********************9.99************************************** PP TIGR00070 71 leE......sead.....vvelldlgfgkcklvlAvpeesdvesledlkegkriATkypnltreylekkgv 130 leE + +++l +l+fg c+l+lA+p +++++ ++ l+ gkriAT+yp+l ++yl++kg+ lcl|FitnessBrowser__Koxy:BWI76_RS18920 77 LEEellsrrA--QgedprYFTLRRLDFGGCRLSLATPADEPWDGPAMLN-GKRIATSYPHLLKRYLDQKGI 144 ***8876440..256677*******************************.9******************** PP TIGR00070 131 kveivkleGavElapllgladaIvDivetGttLrengLkiieeilessarlia 183 +++ + l+G+vE+ap++gladaI+D+v+tG+tL++ngL+++e++++s+a+li+ lcl|FitnessBrowser__Koxy:BWI76_RS18920 145 SFKSCLLNGSVEVAPRAGLADAICDLVSTGATLEANGLREVEVMFRSKACLIQ 197 ***************************************************95 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (183 nodes) Target sequences: 1 (299 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.02 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory