Align Histidinol-phosphatase; HolPase; EC 3.1.3.15; Histidinol-phosphate phosphatase (uncharacterized)
to candidate BWI76_RS02735 BWI76_RS02735 3'(2'),5'-bisphosphate nucleotidase CysQ
Query= curated2:P56160 (259 letters) >FitnessBrowser__Koxy:BWI76_RS02735 Length = 247 Score = 87.8 bits (216), Expect = 2e-22 Identities = 70/231 (30%), Positives = 111/231 (48%), Gaps = 12/231 (5%) Query: 5 LQLALELAEKAGKLTLD-YFGRRSLQVFSKRDDTPVTEADRNAEELIRQGISAKFPDDGL 63 L+ +LA AG ++ Y G++ + + SK+DD+PVT AD A ++I G+ A PD + Sbjct: 2 LEQVCQLARNAGDAIMEVYDGKQPMDIASKKDDSPVTAADIAAHKVIISGLLALTPDIPV 61 Query: 64 FGEEFDEHPSGNGRR-----WIIDPIDGTRSFIHGVPLYGVMIALEVEGAMQLGVINFPA 118 EE + P+ R+ W++DP+DGT+ FI + V IAL G LGV+ P Sbjct: 62 LSEE--DPPAWEVRQHWQRYWLVDPLDGTKEFIKRNGEFTVNIALIENGKPILGVVYAPV 119 Query: 119 LGELYQAERGSGAFMNGSPVQVSAIAENSASTVVFTEKEYLLDPPSNHPVDQLRIDAGLV 178 + +Y AE+G A+ V+ ++ +V + + DP ++QL Sbjct: 120 MKVMYSAEKGK-AWKEECGVRKQIQVRDARPPLVVISRSHGNDPELQEYLEQL--GEHQT 176 Query: 179 RGWGDCYGHMLVASGRAEVAVD-KIMSPWDCAAVIPIVEEAGGCCFDYRGR 228 G LVA G+A++ S WD AA + AG D++GR Sbjct: 177 TSIGSSLKFCLVAEGQAQLYPRFGPTSTWDTAAGHAVASAAGAHVHDWQGR 227 Lambda K H 0.319 0.138 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 247 Length adjustment: 24 Effective length of query: 235 Effective length of database: 223 Effective search space: 52405 Effective search space used: 52405 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory