GapMind for Amino acid biosynthesis

 

Alignments for a candidate for leuC in Klebsiella michiganensis M5al

Align 3-isopropylmalate dehydratase large subunit; EC 4.2.1.33 (characterized)
to candidate BWI76_RS04670 BWI76_RS04670 3-isopropylmalate dehydratase large subunit

Query= CharProtDB::CH_024771
         (466 letters)



>FitnessBrowser__Koxy:BWI76_RS04670
          Length = 466

 Score =  900 bits (2326), Expect = 0.0
 Identities = 446/466 (95%), Positives = 458/466 (98%)

Query: 1   MAKTLYEKLFDAHVVYEAENETPLLYIDRHLVHEVTSPQAFDGLRAHGRPVRQPGKTFAT 60
           MAKTLYEKLFDAHVVYEA+NETPLLYIDRHLVHEVTSPQAFDGLRAH RPVRQPGKTFAT
Sbjct: 1   MAKTLYEKLFDAHVVYEAQNETPLLYIDRHLVHEVTSPQAFDGLRAHKRPVRQPGKTFAT 60

Query: 61  MDHNVSTQTKDINACGEMARIQMQELIKNCKEFGVELYDLNHPYQGIVHVMGPEQGVTLP 120
           MDHNVSTQTKDINA GEMARIQMQELIKNCKEFGVELYDLNHP+QGIVHVMGPEQGVTLP
Sbjct: 61  MDHNVSTQTKDINASGEMARIQMQELIKNCKEFGVELYDLNHPFQGIVHVMGPEQGVTLP 120

Query: 121 GMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLKQGRAKTMKIEVQGKAAPGITA 180
           GMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLKQGRAKTMKIEV+GKAAPGITA
Sbjct: 121 GMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLKQGRAKTMKIEVKGKAAPGITA 180

Query: 181 KDIVLAIIGKTGSAGGTGHVVEFCGEAIRDLSMEGRMTLCNMAIEMGAKAGLVAPDETTF 240
           KDIVLAIIGKTGSAGGTGHVVEFCGEAIRDLSMEGRMTLCNMAIEMGAKAGLVAPD+TTF
Sbjct: 181 KDIVLAIIGKTGSAGGTGHVVEFCGEAIRDLSMEGRMTLCNMAIEMGAKAGLVAPDQTTF 240

Query: 241 NYVKGRLHAPKGKDFDDAVAYWKTLQTDEGATFDTVVTLQAEEISPQVTWGTNPGQVISV 300
           +YVKGRLHAPKG DF DAVAYWKTL TD+GATFD+VVTLQAEEI+PQVTWGTNPGQVISV
Sbjct: 241 DYVKGRLHAPKGVDFADAVAYWKTLTTDDGATFDSVVTLQAEEIAPQVTWGTNPGQVISV 300

Query: 301 NDNIPDPASFADPVERASAEKALAYMGLKPGIPLTEVAIDKVFIGSCTNSRIEDLRAAAE 360
            D IPDPASF+DPVERASAEKALAYMGLK G+PLTEVAIDKVFIGSCTNSRIEDLRAAAE
Sbjct: 301 TDIIPDPASFSDPVERASAEKALAYMGLKSGVPLTEVAIDKVFIGSCTNSRIEDLRAAAE 360

Query: 361 IAKGRKVAPGVQALVVPGSGPVKAQAEAEGLDKIFIEAGFEWRLPGCSMCLAMNNDRLNP 420
           IAKGRKVAPGVQALVVPGSGPVKAQAEAEGLDKIFIEAGFEWRLPGCSMCLAMNNDRLNP
Sbjct: 361 IAKGRKVAPGVQALVVPGSGPVKAQAEAEGLDKIFIEAGFEWRLPGCSMCLAMNNDRLNP 420

Query: 421 GERCASTSNRNFEGRQGRGGRTHLVSPAMAAAAAVTGHFADIRNIK 466
           GERCASTSNRNFEGRQGRGGRTHLVSPAMAAAAAVTGHFADIR++K
Sbjct: 421 GERCASTSNRNFEGRQGRGGRTHLVSPAMAAAAAVTGHFADIRSLK 466


Lambda     K      H
   0.317    0.134    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 973
Number of extensions: 21
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 466
Length of database: 466
Length adjustment: 33
Effective length of query: 433
Effective length of database: 433
Effective search space:   187489
Effective search space used:   187489
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)

Align candidate BWI76_RS04670 BWI76_RS04670 (3-isopropylmalate dehydratase large subunit)
to HMM TIGR00170 (leuC: 3-isopropylmalate dehydratase, large subunit (EC 4.2.1.33))

Software error:

../bin/blast/fastacmd -i /tmp/list.7228.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.7228.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.