GapMind for Amino acid biosynthesis

 

Alignments for a candidate for asd in Klebsiella michiganensis M5al

Align aspartate-semialdehyde dehydrogenase (characterized)
to candidate BWI76_RS26220 BWI76_RS26220 aspartate-semialdehyde dehydrogenase

Query= CharProtDB::CH_024631
         (367 letters)



>FitnessBrowser__Koxy:BWI76_RS26220
          Length = 368

 Score =  687 bits (1772), Expect = 0.0
 Identities = 343/368 (93%), Positives = 357/368 (97%), Gaps = 1/368 (0%)

Query: 1   MKNVGFIGWRGMVGSVLMQRMVEERDFDAIRPVFFSTSQLGQAAPSFGGTTG-TLQDAFD 59
           MKNVGFIGWRGMVGSVLMQRMVEERDFDAIRPVFFSTSQLGQ APSFGG+TG TLQDAFD
Sbjct: 1   MKNVGFIGWRGMVGSVLMQRMVEERDFDAIRPVFFSTSQLGQPAPSFGGSTGGTLQDAFD 60

Query: 60  LEALKALDIIVTCQGGDYTNEIYPKLRESGWQGYWIDAASSLRMKDDAIIILDPVNQDVI 119
           LEALKALDIIVTCQGGDYTN+IYPKLRESGWQGYWIDAASSLRMKDDAIIILDPVNQDVI
Sbjct: 61  LEALKALDIIVTCQGGDYTNDIYPKLRESGWQGYWIDAASSLRMKDDAIIILDPVNQDVI 120

Query: 120 TDGLNNGIRTFVGGNCTVSLMLMSLGGLFANDLVDWVSVATYQAASGGGARHMRELLTQM 179
           T GLNNG++TFVGGNCTVSLMLMSLGGLFA DLV+WVSVATYQAASGGGARHMRELLTQM
Sbjct: 121 TAGLNNGVKTFVGGNCTVSLMLMSLGGLFAQDLVEWVSVATYQAASGGGARHMRELLTQM 180

Query: 180 GHLYGHVADELATPSSAILDIERKVTTLTRSGELPVDNFGVPLAGSLIPWIDKQLDNGQS 239
           G L+ HVA ELA P+SAIL+IERKVT+LTRSGEL VDNFGVPLAGSLIPWIDKQLDNGQS
Sbjct: 181 GQLHSHVAAELADPASAILEIERKVTSLTRSGELAVDNFGVPLAGSLIPWIDKQLDNGQS 240

Query: 240 REEWKGQAETNKILNTSSVIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAAHN 299
           REEWKGQAETNKIL T+S IPVDGLCVRVGALRCHSQAFTIKLKK+VSIPTVEELLAAHN
Sbjct: 241 REEWKGQAETNKILATASPIPVDGLCVRVGALRCHSQAFTIKLKKEVSIPTVEELLAAHN 300

Query: 300 PWAKVVPNDREITMRELTPAAVTGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAAEPL 359
           PWAKVVPNDR+ITMRELTPAAVTGTLTTPVGRLRKLNMGPE+LSAFTVGDQLLWGAAEPL
Sbjct: 301 PWAKVVPNDRDITMRELTPAAVTGTLTTPVGRLRKLNMGPEYLSAFTVGDQLLWGAAEPL 360

Query: 360 RRMLRQLA 367
           RRML+QLA
Sbjct: 361 RRMLKQLA 368


Lambda     K      H
   0.319    0.136    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 582
Number of extensions: 14
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 367
Length of database: 368
Length adjustment: 30
Effective length of query: 337
Effective length of database: 338
Effective search space:   113906
Effective search space used:   113906
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

Align candidate BWI76_RS26220 BWI76_RS26220 (aspartate-semialdehyde dehydrogenase)
to HMM TIGR01745 (asd: aspartate-semialdehyde dehydrogenase (EC 1.2.1.11))

Software error:

../bin/blast/fastacmd -i /tmp/list.20632.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.20632.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.