GapMind for Amino acid biosynthesis

 

Alignments for a candidate for asp-kinase in Klebsiella michiganensis M5al

Align aspartate kinase (EC 2.7.2.4) (characterized)
to candidate BWI76_RS01790 BWI76_RS01790 lysine-sensitive aspartokinase 3

Query= BRENDA::P08660
         (449 letters)



>FitnessBrowser__Koxy:BWI76_RS01790
          Length = 449

 Score =  760 bits (1963), Expect = 0.0
 Identities = 390/449 (86%), Positives = 417/449 (92%)

Query: 1   MSEIVVSKFGGTSVADFDAMNRSADIVLSDANVRLVVLSASAGITNLLVALAEGLEPGER 60
           M+++VV+KFGGTSVADFDAMNRS D+ L DAN R+VVLSASAG+TNLLVALAEGLEPGER
Sbjct: 1   MTDLVVAKFGGTSVADFDAMNRSVDVALLDANTRVVVLSASAGVTNLLVALAEGLEPGER 60

Query: 61  FEKLDAIRNIQFAILERLRYPNVIREEIERLLENITVLAEAAALATSPALTDELVSHGEL 120
           F KLDA+R IQF ILERLRYPNVIR+EIERLLENIT LAEAA+LA+S ALTDELVSHGEL
Sbjct: 61  FAKLDAMRQIQFNILERLRYPNVIRDEIERLLENITTLAEAASLASSTALTDELVSHGEL 120

Query: 121 MSTLLFVEILRERDVQAQWFDVRKVMRTNDRFGRAEPDIAALAELAALQLLPRLNEGLVI 180
           MSTLLFVEILRER + AQWFDVRK+MRTNDRFGRAEPDIAAL+EL   QL PRL EGLVI
Sbjct: 121 MSTLLFVEILRERGIAAQWFDVRKIMRTNDRFGRAEPDIAALSELTQQQLTPRLAEGLVI 180

Query: 181 TQGFIGSENKGRTTTLGRGGSDYTAALLAEALHASRVDIWTDVPGIYTTDPRVVSAAKRI 240
           TQGFIGSE KGRTTTLGRGGSDYTAALL EAL+A+RVDIWTDVPGIYTTDPRV  AAKRI
Sbjct: 181 TQGFIGSEAKGRTTTLGRGGSDYTAALLGEALNATRVDIWTDVPGIYTTDPRVAPAAKRI 240

Query: 241 DEIAFAEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPRAGGTLVCNKTENPPLFR 300
           D IAF EAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSK+P+AGGTLVC  T+NPPLFR
Sbjct: 241 DVIAFEEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKEPKAGGTLVCKNTKNPPLFR 300

Query: 301 ALALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSVALTLDTTGSTS 360
           ALALRR QTLLTLHSLNMLHSRGFLAEVF ILARH+ISVDLITTSEVSVALT+DTTGSTS
Sbjct: 301 ALALRRKQTLLTLHSLNMLHSRGFLAEVFSILARHSISVDLITTSEVSVALTMDTTGSTS 360

Query: 361 TGDTLLTQSLLMELSALCRVEVEEGLALVALIGNDLSKACGVGKEVFGVLEPFNIRMICY 420
            GDTLLTQ LL ELS+LCRVEVE+ LALVA+IGN+LSKACGVGKEVFGVL+PFNIRMICY
Sbjct: 361 AGDTLLTQGLLTELSSLCRVEVEQDLALVAIIGNELSKACGVGKEVFGVLDPFNIRMICY 420

Query: 421 GASSHNLCFLVPGEDAEQVVQKLHSNLFE 449
           GASSHNLCFLVPG DAE+VVQKLH NLFE
Sbjct: 421 GASSHNLCFLVPGADAEKVVQKLHHNLFE 449


Lambda     K      H
   0.320    0.135    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 633
Number of extensions: 15
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 449
Length of database: 449
Length adjustment: 33
Effective length of query: 416
Effective length of database: 416
Effective search space:   173056
Effective search space used:   173056
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

Align candidate BWI76_RS01790 BWI76_RS01790 (lysine-sensitive aspartokinase 3)
to HMM TIGR00656 (aspartate kinase, monofunctional class (EC 2.7.2.4))

Software error:

../bin/blast/fastacmd -i /tmp/list.10660.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.10660.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.