GapMind for Amino acid biosynthesis

 

Alignments for a candidate for asp-kinase in Klebsiella michiganensis M5al

Align fused aspartate kinase/homoserine dehydrogenase 1 (EC 2.7.2.4; EC 1.1.1.3) (characterized)
to candidate BWI76_RS04245 BWI76_RS04245 bifunctional aspartate kinase/homoserine dehydrogenase I

Query= ecocyc::ASPKINIHOMOSERDEHYDROGI-MONOMER
         (820 letters)



>FitnessBrowser__Koxy:BWI76_RS04245
          Length = 820

 Score = 1495 bits (3871), Expect = 0.0
 Identities = 756/820 (92%), Positives = 794/820 (96%)

Query: 1   MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHLVAMIEKTISGQDA 60
           MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHLVAMIEKTI GQDA
Sbjct: 1   MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHLVAMIEKTIGGQDA 60

Query: 61  LPNISDAERIFAELLTGLAAAQPGFPLAQLKTFVDQEFAQIKHVLHGISLLGQCPDSINA 120
           L NI+DAERIFAELL GLA AQPGFPLAQLK FV+QEFAQIKHVLHGISLLGQCPDS+NA
Sbjct: 61  LTNIADAERIFAELLQGLADAQPGFPLAQLKAFVEQEFAQIKHVLHGISLLGQCPDSVNA 120

Query: 121 ALICRGEKMSIAIMAGVLEARGHNVTVIDPVEKLLAVGHYLESTVDIAESTRRIAASRIP 180
           +LICRGEK+SIAIMAG+LEARGHNVTVI+PVEKLLAVGHYLESTVDIAESTRRIAAS+IP
Sbjct: 121 SLICRGEKLSIAIMAGLLEARGHNVTVINPVEKLLAVGHYLESTVDIAESTRRIAASQIP 180

Query: 181 ADHMVLMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRQV 240
           ADHMVLMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRQV
Sbjct: 181 ADHMVLMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRQV 240

Query: 241 PDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCLIKNTGNPQAPGTLIGASRD 300
           PDARLLKSMSYQEAMELSYFGAKVLHPRTI PIAQFQIPCLIKNTGNPQAPGTLIGASRD
Sbjct: 241 PDARLLKSMSYQEAMELSYFGAKVLHPRTIAPIAQFQIPCLIKNTGNPQAPGTLIGASRD 300

Query: 301 EDELPVKGISNLNNMAMFSVSGPGMKGMVGMAARVFAAMSRARISVVLITQSSSEYSISF 360
           ED+LPVKGISNLNNMAMF+VSGPGMKGMVGMAARVFA MSRA ISVVLITQSSSEYSISF
Sbjct: 301 EDDLPVKGISNLNNMAMFNVSGPGMKGMVGMAARVFATMSRAGISVVLITQSSSEYSISF 360

Query: 361 CVPQSDCVRAERAMQEEFYLELKEGLLEPLAVTERLAIISVVGDGMRTLRGISAKFFAAL 420
           CVPQSDC RA+R M++EFYLELKEGLLEPL++ ERLAIISVVGDGMRTLRGISAKFFAAL
Sbjct: 361 CVPQSDCARAKRVMEDEFYLELKEGLLEPLSIMERLAIISVVGDGMRTLRGISAKFFAAL 420

Query: 421 ARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQMLFNTDQVIEVFVIGVGGVGGAL 480
           ARANINIVAIAQGSSERSISVVV+NDDATTGVRVTHQMLFNTDQVIEVFVIG+GGVGGAL
Sbjct: 421 ARANINIVAIAQGSSERSISVVVSNDDATTGVRVTHQMLFNTDQVIEVFVIGIGGVGGAL 480

Query: 481 LEQLKRQQSWLKNKHIDLRVCGVANSKALLTNVHGLNLENWQEELAQAKEPFNLGRLIRL 540
           +EQ+KRQQSWLK+KHIDLRVCGVANS+ALLTNVHGLNLE+W++ELA+AKE FNLGRLIRL
Sbjct: 481 IEQIKRQQSWLKSKHIDLRVCGVANSRALLTNVHGLNLEHWRDELAEAKEAFNLGRLIRL 540

Query: 541 VKEYHLLNPVIVDCTSSQAVADQYADFLREGFHVVTPNKKANTSSMDYYHQLRYAAEKSR 600
           VKEYHLLNPVIVDCTSSQAVADQYADFLREGFHVVTPNKKANTSS+DYYHQLR+AA  SR
Sbjct: 541 VKEYHLLNPVIVDCTSSQAVADQYADFLREGFHVVTPNKKANTSSLDYYHQLRHAASSSR 600

Query: 601 RKFLYDTNVGAGLPVIENLQNLLNAGDELMKFSGILSGSLSYIFGKLDEGMSFSEATTLA 660
           RKFLYDTNVGAGLPVIENLQNLLNAGDEL++FSGILSGSLS+IFGKLDEG+SFSEAT LA
Sbjct: 601 RKFLYDTNVGAGLPVIENLQNLLNAGDELLRFSGILSGSLSFIFGKLDEGVSFSEATRLA 660

Query: 661 REMGYTEPDPRDDLSGMDVARKLLILARETGRELELADIEIEPVLPAEFNAEGDVAAFMA 720
           REMGYTEPDPRDDLSG+DVARKLLILARETGRELEL+DI +EP LPA F+A GDV +FMA
Sbjct: 661 REMGYTEPDPRDDLSGVDVARKLLILARETGRELELSDIIVEPALPAGFDASGDVDSFMA 720

Query: 721 NLSQLDDLFAARVAKARDEGKVLRYVGNIDEDGVCRVKIAEVDGNDPLFKVKNGENALAF 780
            L  LDD FA+RVAKARDEGKVLRYVGNI+EDG CRVKIA VDGNDPLFKVKNGENALAF
Sbjct: 721 RLPSLDDEFASRVAKARDEGKVLRYVGNIEEDGTCRVKIAAVDGNDPLFKVKNGENALAF 780

Query: 781 YSHYYQPLPLVLRGYGAGNDVTAAGVFADLLRTLSWKLGV 820
           YSHYYQPLPLVLRGYGAGNDVTAAGVFADLLRTLSWKLGV
Sbjct: 781 YSHYYQPLPLVLRGYGAGNDVTAAGVFADLLRTLSWKLGV 820


Lambda     K      H
   0.319    0.135    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1881
Number of extensions: 50
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 820
Length of database: 820
Length adjustment: 42
Effective length of query: 778
Effective length of database: 778
Effective search space:   605284
Effective search space used:   605284
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 56 (26.2 bits)

Align candidate BWI76_RS04245 BWI76_RS04245 (bifunctional aspartate kinase/homoserine dehydrogenase I)
to HMM TIGR00657 (aspartate kinase (EC 2.7.2.4))

Software error:

../bin/blast/fastacmd -i /tmp/list.21121.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.21121.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.