Align 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 (characterized)
to candidate BWI76_RS03425 BWI76_RS03425 dihydrodipicolinate synthase family protein
Query= SwissProt::Q07607 (292 letters) >FitnessBrowser__Koxy:BWI76_RS03425 Length = 303 Score = 141 bits (355), Expect = 2e-38 Identities = 95/285 (33%), Positives = 145/285 (50%), Gaps = 5/285 (1%) Query: 1 MFEGSITALVTPF-ADDRIDEVALHDLVEWQIEEGSFGLVPCGTTGESPTLSKSEHEQVV 59 +F G I+A+VTP AD+ ++ AL L Q+ G G CG++GE P L E QV+ Sbjct: 8 VFRGIISAVVTPMHADESVNYAALDALARAQLARGVEGFYCCGSSGEGPLLRFDERRQVL 67 Query: 60 EITIKTANGRVPVIAGAGSNSTAEAIAFVRHAQNAGADGVLIVSPYYNKPTQEGIYQHFK 119 +++A GRVPVIA G+ T +A+ +HA+ GA V +V PYY K ++E I +++ Sbjct: 68 ATLVQSAGGRVPVIAHVGTPRTRDAVELAKHAEQDGASAVSLVPPYYYKYSREEIIAYYR 127 Query: 120 AIDAASTIPIIVYNIPGRSAIEIHVETLARIFEDCPNVKGVKDATGNLLRPSLERM-ACG 178 + A +IP+I+YNIP + +E+ ++ + D V GVK + NL SLERM A Sbjct: 128 RVLDAISIPVILYNIPQFTGVELDAQSADALLGD-EQVLGVKHTSHNLY--SLERMIARY 184 Query: 179 EDFNLLTGEDGTALGYMAHGGHGCISVTANVAPALCADFQQACLNGDFAAALKLQDRLMP 238 + G D L +A G + T N+ P L + A G+ A A +LQ ++ Sbjct: 185 PEKVFFNGFDEIFLSSLAAGATATVGTTVNLQPELFLALRSAFQQGEIARAQRLQQQINE 244 Query: 239 LHRALFLETNPAGAKYALQRLGRMRGDLRLPLVTISPSFQEEIDD 283 + L AKY + G R P V ++ + E+DD Sbjct: 245 VVGQLVARGVFQSAKYLAAKETVDTGPTREPFVALTAVQKGELDD 289 Lambda K H 0.319 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 208 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 303 Length adjustment: 26 Effective length of query: 266 Effective length of database: 277 Effective search space: 73682 Effective search space used: 73682 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory