Align N-acetyldiaminopimelate deacetylase; EC 3.5.1.47 (uncharacterized)
to candidate BWI76_RS13530 BWI76_RS13530 amidohydrolase family protein
Query= curated2:B7GIC0 (378 letters) >FitnessBrowser__Koxy:BWI76_RS13530 Length = 373 Score = 220 bits (560), Expect = 6e-62 Identities = 132/351 (37%), Positives = 182/351 (51%), Gaps = 8/351 (2%) Query: 6 RRDLHQIPELGFQEFKTQQYILDYLATLPSERLQIKTWRTGILVRVHGTAPTKTIGYRAD 65 RR+LHQ PEL QE T I D+L + L +TG + V + K I RAD Sbjct: 11 RRELHQYPELSLQEVDTTARIRDWLQSGGISLLPYDL-KTGAVAEVG--SGNKVIALRAD 67 Query: 66 MDGLPIDEQTDVPFRSTHEGRMHACGHDMHMAIALG--VLTHVVHHPIRDDMLFIFQPAE 123 +D LPI+E VPFRS + G MHACGHD+H ++ LG +L + + +FQPAE Sbjct: 68 IDALPIEEAASVPFRSLNAGVMHACGHDIHTSVILGAALLLKQREAQLAGRVRILFQPAE 127 Query: 124 EGPGGALPMLESDEMKQWMPDMILALHIAPAYPVGTIATKEGLLFANTSELFIDLIGKGG 183 E GGA ++ + ++ I +H P PVG AT+ G +AN + GKG Sbjct: 128 ESFGGAKTLIRAGVLEG--VSAIFGMHNEPGLPVGEFATRGGAFYANVDRFVFKVTGKGA 185 Query: 184 HAAFPHETKDMVVAASSLIMQLQTIVSRNVNPLDSAVITIGKLTSGTVQNVIAERARLEG 243 HAA PHE KD ++ AS L+ LQ++ SR VN LDS V+++ ++ G NV+ E LEG Sbjct: 186 HAARPHEGKDAILLASQLVTLLQSVASREVNTLDSVVLSVTRIQGGNTWNVLPESVELEG 245 Query: 244 TIRTLSPEAMEKVKGRIEAIVRGIEVAYDCQAHIDYGSMYYQVYNDETLTNEFMQFVEKE 303 T+RT S E ++VK R+ I G A+ Q + + + + NDE F V + Sbjct: 246 TLRTHSSEVQQRVKARVSEIAAGFASAFGAQIDVFWYAGPTALVNDERWA-AFASDVADK 304 Query: 304 TDVHLVRCQEAMTGEDFGYMLARIPGFMFWLGVQSPFGLHHAKLNPNEEAI 354 + + GEDF L IPG +G S FGLHH NP+E I Sbjct: 305 SGYRTHHADLHLGGEDFAVYLQHIPGAFVSIGSASEFGLHHPAFNPDERLI 355 Lambda K H 0.322 0.137 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 371 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 378 Length of database: 373 Length adjustment: 30 Effective length of query: 348 Effective length of database: 343 Effective search space: 119364 Effective search space used: 119364 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory