Align homocitrate synthase (EC 2.3.3.14) (characterized)
to candidate BWI76_RS18860 BWI76_RS18860 homocitrate synthase
Query= BRENDA::A0A1Y6KBA1 (416 letters) >FitnessBrowser__Koxy:BWI76_RS18860 Length = 380 Score = 307 bits (787), Expect = 3e-88 Identities = 171/371 (46%), Positives = 229/371 (61%) Query: 38 MPRVILNDTTLRDGEQAPGVAFALSEKVAIARALARAGVPEIEAGTPAMGADEISAIRAI 97 M RV++NDTTLRDGEQ+PGVAF SEKVAIA AL AG+ +E GTPAMG +EI+ I+ + Sbjct: 1 MERVLINDTTLRDGEQSPGVAFRTSEKVAIAEALYAAGITAMEVGTPAMGDEEIARIQLV 60 Query: 98 VEAGLPATIIGWCRMREADVDAAIAAGVSMVNVSIPTSDVQIAAKLGGGRSVALELLKRV 157 AT++ WCRM ++ + G+ V++SIP SD KL +V LE L Sbjct: 61 RRQLPDATLMTWCRMNALEIRQSADLGIDWVDISIPASDKLRQYKLREPLAVLLERLAMF 120 Query: 158 VSYARSRGLGVAVGGEDSSRADVGFLAEVIATAKALGARRFRVADTLSVLDPDATSALVG 217 + A + GL V +G ED+SRA L + A+ A R R ADT+ +LDP T+A + Sbjct: 121 IHLAHTLGLKVCIGCEDASRASGQTLRAIAEVAQQCAAARLRYADTVGLLDPFTTAAQIS 180 Query: 218 ALRATTDLEIEFHGHDDLGLATANTLAAIKAGATHASVTVIGLGERAGNAPLEEVAVALR 277 ALR EIE H H+DLG+ATANTLAA+ AGAT + TV+GLGERAGNA LE VA+ L Sbjct: 181 ALRDVWSGEIEMHAHNDLGMATANTLAAVSAGATSVNTTVLGLGERAGNAALETVALGLE 240 Query: 278 QLYRRETGIVLAELDHVANVVAAAAARAIPLNKAIVGEHVFTHESGIHVDGLLKDQRTYQ 337 + ETG+ + L + VA AA RAI + +VGE VFTHESG+HV LL+D +YQ Sbjct: 241 RCLGVETGVHFSALPALCQRVAEAAQRAIDPQQPLVGELVFTHESGVHVAALLRDSESYQ 300 Query: 338 ALDPMLFGRSNRIVIGKHSGLSAITSLLSDLRLPASADQAQRILARVRKHAVAHKGPVPK 397 ++ P L GRS R+V+GKHSG A+ + + +A Q ++L +R+ A K Sbjct: 301 SIAPSLMGRSYRLVLGKHSGRQAVNGVFDQMGYHLNAAQINQLLPAIRRFAENWKRSPKD 360 Query: 398 EAVAAIWREVC 408 + AI+ E+C Sbjct: 361 YELVAIYDELC 371 Lambda K H 0.317 0.132 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 358 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 380 Length adjustment: 31 Effective length of query: 385 Effective length of database: 349 Effective search space: 134365 Effective search space used: 134365 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate BWI76_RS18860 BWI76_RS18860 (homocitrate synthase)
to HMM TIGR02660 (nifV: homocitrate synthase (EC 2.3.3.14))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR02660.hmm # target sequence database: /tmp/gapView.8535.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02660 [M=365] Accession: TIGR02660 Description: nifV_homocitr: homocitrate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-168 545.3 1.1 4.5e-168 545.1 1.1 1.0 1 lcl|FitnessBrowser__Koxy:BWI76_RS18860 BWI76_RS18860 homocitrate syntha Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Koxy:BWI76_RS18860 BWI76_RS18860 homocitrate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 545.1 1.1 4.5e-168 4.5e-168 2 365 .] 4 367 .. 3 367 .. 1.00 Alignments for each domain: == domain 1 score: 545.1 bits; conditional E-value: 4.5e-168 TIGR02660 2 vlinDttLRDGEqaagvaFsaeEKlaiAkaLdeaGvdelEvGipamgeeEraairaiaalglkarllaWcR 72 vlinDttLRDGEq++gvaF+++EK+aiA+aL++aG++ +EvG+pamg+eE+a+i+ ++++ ++a+l++WcR lcl|FitnessBrowser__Koxy:BWI76_RS18860 4 VLINDTTLRDGEQSPGVAFRTSEKVAIAEALYAAGITAMEVGTPAMGDEEIARIQLVRRQLPDATLMTWCR 74 89********************************************************************* PP TIGR02660 73 lraedieaaaevGvkavdlsvpvsdlqleaklkkdrawvleelkelvslakeeglkvsvgaeDasRadeef 143 ++a +i+++a++G+++vd+s+p+sd+ +++kl++ a++le+l+++++la++ glkv++g+eDasRa+ ++ lcl|FitnessBrowser__Koxy:BWI76_RS18860 75 MNALEIRQSADLGIDWVDISIPASDKLRQYKLREPLAVLLERLAMFIHLAHTLGLKVCIGCEDASRASGQT 145 *********************************************************************** PP TIGR02660 144 lvelaevakeagakRlRfaDtvgvldPfstyelvkalraalelelElHaHnDlGlAtAntlaavkaGassv 214 l+++aeva++ a+RlR+aDtvg+ldPf+t+++++alr+ ++ e+E+HaHnDlG+AtAntlaav+aGa+sv lcl|FitnessBrowser__Koxy:BWI76_RS18860 146 LRAIAEVAQQCAAARLRYADTVGLLDPFTTAAQISALRDVWSGEIEMHAHNDLGMATANTLAAVSAGATSV 216 *********************************************************************** PP TIGR02660 215 svtvlGlGERAGnAaleevalalkellgldtgidlselkelsqlvakasgraleaqkavvGesvFaHEsGi 285 ++tvlGlGERAGnAale val+l+++lg++tg+++s+l++l+q va+a++ra+++q+++vGe vF+HEsG+ lcl|FitnessBrowser__Koxy:BWI76_RS18860 217 NTTVLGLGERAGNAALETVALGLERCLGVETGVHFSALPALCQRVAEAAQRAIDPQQPLVGELVFTHESGV 287 *********************************************************************** PP TIGR02660 286 HvdgllkdeatYesldPeevGrerelviGKHsgraaviealkelgleleeeeaeelleavravaerlKrsl 356 Hv++ll+d+++Y+s++P+++Gr+++lv+GKHsgr+av+ +++++g++l+++++++ll+a+r++ae++Krs+ lcl|FitnessBrowser__Koxy:BWI76_RS18860 288 HVAALLRDSESYQSIAPSLMGRSYRLVLGKHSGRQAVNGVFDQMGYHLNAAQINQLLPAIRRFAENWKRSP 358 *********************************************************************** PP TIGR02660 357 eeeelaalv 365 ++ el+a++ lcl|FitnessBrowser__Koxy:BWI76_RS18860 359 KDYELVAIY 367 *****9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (365 nodes) Target sequences: 1 (380 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.15 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory