GapMind for Amino acid biosynthesis

 

Alignments for a candidate for hcs in Klebsiella michiganensis M5al

Align Homocitrate synthase; EC 2.3.3.14 (characterized)
to candidate BWI76_RS18860 BWI76_RS18860 homocitrate synthase

Query= SwissProt::P05342
         (385 letters)



>FitnessBrowser__Koxy:BWI76_RS18860
          Length = 380

 Score =  305 bits (782), Expect = 1e-87
 Identities = 169/383 (44%), Positives = 231/383 (60%), Gaps = 3/383 (0%)

Query: 1   MASVIIDDTTLRDGEQSAGVAFNADEKIAIARALAELGVPELEIGIPSMGEEEREVMHAI 60
           M  V+I+DTTLRDGEQS GVAF   EK+AIA AL   G+  +E+G P+MG+EE   +  +
Sbjct: 1   MERVLINDTTLRDGEQSPGVAFRTSEKVAIAEALYAAGITAMEVGTPAMGDEEIARIQLV 60

Query: 61  AGLGLSSRLLAWCRLCDVDLAAARSTGVTMVDLSLPVSDLMLHHKLNRDRDWALREVARL 120
                 + L+ WCR+  +++  +   G+  VD+S+P SD +  +KL       L  +A  
Sbjct: 61  RRQLPDATLMTWCRMNALEIRQSADLGIDWVDISIPASDKLRQYKLREPLAVLLERLAMF 120

Query: 121 VGEARMAGLEVCLGCEDASRADLEFVVQVGEVAQAAGARRLRFADTVGVMEPFGMLDRFR 180
           +  A   GL+VC+GCEDASRA  + +  + EVAQ   A RLR+ADTVG+++PF    +  
Sbjct: 121 IHLAHTLGLKVCIGCEDASRASGQTLRAIAEVAQQCAAARLRYADTVGLLDPFTTAAQIS 180

Query: 181 FLSRRLDMELEVHAHDDFGLATANTLAAVMGGATHINTTVNGLGERAGNAALEECVLALK 240
            L      E+E+HAH+D G+ATANTLAAV  GAT +NTTV GLGERAGNAALE   L L+
Sbjct: 181 ALRDVWSGEIEMHAHNDLGMATANTLAAVSAGATSVNTTVLGLGERAGNAALETVALGLE 240

Query: 241 NLHGIDTGIDTRGIPAISALVERASGRQVAWQKSVVGAGVFTHEAGIHVDGLLKHRRNYE 300
              G++TG+    +PA+   V  A+ R +  Q+ +VG  VFTHE+G+HV  LL+   +Y+
Sbjct: 241 RCLGVETGVHFSALPALCQRVAEAAQRAIDPQQPLVGELVFTHESGVHVAALLRDSESYQ 300

Query: 301 GLNPDELGRSHSLVLGKHSGAHMVRNTYRDLGIELADWQSQALLGRIRAFSTRTKRRSPQ 360
            + P  +GRS+ LVLGKHSG   V   +  +G  L   Q   LL  IR F+   K RSP+
Sbjct: 301 SIAPSLMGRSYRLVLGKHSGRQAVNGVFDQMGYHLNAAQINQLLPAIRRFAENWK-RSPK 359

Query: 361 PAELQDFYRQLCEQGNPELAAGG 383
             EL   Y +LC  G   L A G
Sbjct: 360 DYELVAIYDELC--GESALRARG 380


Lambda     K      H
   0.320    0.135    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 431
Number of extensions: 24
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 385
Length of database: 380
Length adjustment: 30
Effective length of query: 355
Effective length of database: 350
Effective search space:   124250
Effective search space used:   124250
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

Align candidate BWI76_RS18860 BWI76_RS18860 (homocitrate synthase)
to HMM TIGR02660 (nifV: homocitrate synthase (EC 2.3.3.14))

Software error:

../bin/blast/fastacmd -i /tmp/list.20754.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.20754.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.