Align 2-aminoadipate transaminase (2.6.1.39) (characterized)
to candidate BWI76_RS26375 BWI76_RS26375 aspartate aminotransferase family protein
Query= reanno::Putida:PP_4108 (416 letters) >FitnessBrowser__Koxy:BWI76_RS26375 Length = 421 Score = 335 bits (858), Expect = 2e-96 Identities = 173/411 (42%), Positives = 243/411 (59%), Gaps = 3/411 (0%) Query: 3 QESISQSIAIVHPITLSHGRNAEVWDTDGKRYIDFVGGIGVLNLGHCNPAVVEAIQAQAT 62 Q++ + + ++ + NA +WD +G IDF GI VLN GH +P ++ A++ Q Sbjct: 11 QQATPRGVGVMCSYFVEKAENATLWDIEGNEVIDFAAGIAVLNTGHRHPKIIAAVEQQLQ 70 Query: 63 RLTHYAFNAAPHGPYLALMEQLSQFVPVSYPLAGMLTNSGAEAAENALKVARGATGKRAI 122 TH A+ P+ Y+ L E+++ P+ P +GAEA ENA+K+AR TG+ + Sbjct: 71 AFTHTAYQIVPYESYVTLAERINALAPIDGPAKTAFFTTGAEAVENAVKIARAYTGRPGL 130 Query: 123 IAFDGGFHGRTLATLNLNGKVAPYKQRVGELPGPVYHLPYPSADTGVTCEQALKAMDRLF 182 I F GGFHGRT T+ L GKVAPYK G PG VYH YP+A G+T A+K++DR+F Sbjct: 131 ITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHAVYPNAAHGITTADAMKSLDRIF 190 Query: 183 SVELAVEDVAAFIFEPVQGEGGFLALDPAFAQALRRFCDERGILIIIDEIQSGFGRTGQR 242 ++A + VAA + EP+QGEGGF P F QALR CD GIL+I DE+Q+GF RTG+ Sbjct: 191 KADIAADQVAAIVLEPIQGEGGFNVAPPEFMQALRALCDTHGILLIADEVQTGFARTGKL 250 Query: 243 FAFPRLGIEPDLLLLAKSIAGGMPLGAVVGRKELMAALPKGGLGGTYSGNPISCAAALAS 302 FA ++PDL+ +AKS+AGG PL VVGR E+M A GGLGGTY+GNP++ AAA A Sbjct: 251 FAMQHYDVKPDLMTMAKSLAGGFPLSGVVGRAEVMDAPAPGGLGGTYAGNPLAVAAAHAV 310 Query: 303 LAQMTDENLATWGERQEQAIVSRYERWKASGLSPYIGRLTGVGAMRGIEFANAD-GSPAP 361 L + +E L ER + + + S P I + G G+M +EF + G P+ Sbjct: 311 LDVIEEEQLCQRAERLGSHLKEVLNQARQS--CPAIADVRGQGSMVAVEFNDPQTGEPSA 368 Query: 362 AQLAKVMEAARARGLLLMPSGKARHIIRLLAPLTIEAEVLEEGLDILEQCL 412 ++ + A+ GLLL+ G ++IR L PLTI + LDIL + L Sbjct: 369 EITRQIQQKAQENGLLLLSCGVYGNVIRFLYPLTIPDAQFTKALDILARVL 419 Lambda K H 0.320 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 516 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 421 Length adjustment: 32 Effective length of query: 384 Effective length of database: 389 Effective search space: 149376 Effective search space used: 149376 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory