Align Cystathionine gamma-synthase/O-acetylhomoserine (thiol)-lyase; CGS/OAH thiolyase; O-acetylhomoserine sulfhydrylase; OAH sulfhydrylase; EC 2.5.1.- (characterized)
to candidate BWI76_RS16730 BWI76_RS16730 cystathionine gamma-lyase
Query= SwissProt::O31631 (373 letters) >FitnessBrowser__Koxy:BWI76_RS16730 Length = 395 Score = 258 bits (658), Expect = 3e-73 Identities = 146/378 (38%), Positives = 214/378 (56%), Gaps = 18/378 (4%) Query: 2 SQHVETKLAQIGNRSDEVTGTVSAPIYLSTAYRHRGIGESTGFDYVRTKNPTRQLVEDAI 61 ++ + T GN+SD VT + PI ++++ + E F Y R NPTR+ E A+ Sbjct: 5 TKDIATLAVHAGNQSDPVTHAIFTPIVTASSFIQPNLYEGGDFCYSRVSNPTRKAYESAL 64 Query: 62 ANLENGARGLAFSSGMAAIQTIMALFKSGDELIVSSDLYGGTYRLFEN-EWKKYGLTFHY 120 A LE G A +SGMAA +M L +I +YGGT+RLFE + G+T Y Sbjct: 65 AELEGGIYATATASGMAATNIVMELLPKDAHIIAMKGVYGGTWRLFEKLKTHTTGVTISY 124 Query: 121 DDFSDEDCLRSKITPNTKAVFVETPTNPLMQEADIEHIARITKEHGLLLIVDNTFYTPVL 180 D +DE L + I NT +++ETPTNPL++ DI + RI KE + VDNTF + Sbjct: 125 IDLNDEQSLINTIQENTALIWIETPTNPLLELVDIAKVCRIAKERAITTCVDNTFASAWN 184 Query: 181 QRPLELGADIVIHSATKYLGGHNDLLAGLVVVKDERLGEEMFQHQNAIGAVLPPFDSWLL 240 +PLE+GAD+V+ S +KY+GGH+DL+ G V+ +E L + + +G++ PFD++L Sbjct: 185 HKPLEMGADMVMLSTSKYVGGHSDLIGGAVITNNEALASRLDFIKTTLGSIASPFDAYLA 244 Query: 241 MRGMKTLSLRMRQHQANAQELAAFLEEQEEISDVLYPG----------------KGGMLS 284 +RGMKTL LRM + NA +A +LE I+ V YPG G +++ Sbjct: 245 LRGMKTLDLRMARQCGNALRVAQYLENHPAIASVYYPGLPSHPQHQLCRQQMRSGGAVVT 304 Query: 285 FRLQKE-EWVNPFLKALKTICFAESLGGVESFITYPATQTHMDIPEEIRIANGVCNRLLR 343 L+ + + + F+ L AESLGGVES I + A+ +H + +E R A GV + LR Sbjct: 305 ATLKGDIQSLKRFIGGLHYFVLAESLGGVESMINHSASMSHGAMSKEEREAIGVYDTTLR 364 Query: 344 FSVGIEHAEDLKEDLKQA 361 FSVGIEH +DL +DL+ A Sbjct: 365 FSVGIEHIDDLLQDLESA 382 Lambda K H 0.319 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 350 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 373 Length of database: 395 Length adjustment: 30 Effective length of query: 343 Effective length of database: 365 Effective search space: 125195 Effective search space used: 125195 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory