Align Probable aspartate/prephenate aminotransferase; AspAT / PAT; EC 2.6.1.1; EC 2.6.1.79; Transaminase A (uncharacterized)
to candidate BWI76_RS20495 BWI76_RS20495 alanine transaminase
Query= curated2:Q4UND3 (409 letters) >FitnessBrowser__Koxy:BWI76_RS20495 Length = 412 Score = 155 bits (392), Expect = 2e-42 Identities = 127/411 (30%), Positives = 204/411 (49%), Gaps = 32/411 (7%) Query: 6 TRLNSIKPSPTLAVVKKTLELKKAGVDIIALGAGEPDFDTPDNIKEAAIKAIKDGFTK-Y 64 TR++ + P + + ++ G DII G PD TP +I E + T Y Sbjct: 11 TRIDRLPPYVFNITAELKMAARRRGEDIIDFSMGNPDGATPPHIVEKLCTVAQRPDTHGY 70 Query: 65 TNVEGMPLLKQAIKDKFKRENNIDYELD-EIIVSTGGKQVIYNLFMASLDKGDKVIIPAP 123 + G+P L++AI ++ N++ + + E IV+ G K+ + +L +A+LD GD V++P P Sbjct: 71 STSRGIPRLRRAISRWYQERYNVEIDPESEAIVTIGSKEGLAHLMLATLDHGDTVLVPNP 130 Query: 124 YWVSYPDMV--ALSTGTPVFVNCGIEN-NFKLSAEALERSITDKTKWLIINSPSNPTGAS 180 SYP + A+ G V +E +F E R K K +I+ PSNPT Sbjct: 131 ---SYPIHIYGAVIAGAQVRSVPLVEGVDFFNELERAIRESYPKPKMMILGFPSNPTAQC 187 Query: 181 YNFEELENIAKVLRKYPHVNVMSDDIYEHITFDDFKFYTLAQI--APDLKERIFTVNGVS 238 E E + + ++Y V V+ D Y I +D +K ++ Q+ A D+ FT+ S Sbjct: 188 VELEFFEKVVALAKRYD-VLVVHDLAYADIVYDGWKAPSIMQVPGARDVAVEFFTL---S 243 Query: 239 KAYSMTGWRIGYGVGSKALIKAMTIIQSQSTSNPCSISQMAAIESLNGPQDYIKPNALNF 298 K+Y+M GWRIG+ VG+K L+ A+ I+S + Q+AAI +L G Q ++ A + Sbjct: 244 KSYNMAGWRIGFMVGNKTLVNALARIKSYHDYGTFTPLQVAAIAALEGDQQCVRDIAEQY 303 Query: 299 QKKRDLALSILKRVKYF-ECYKPEGAFYLFVKCDKIFGHKTKSGKIIANSNDFAEYLLEE 357 +++RD+ + L + EC P+ + Y++ K + + S +FA+ LL++ Sbjct: 304 KRRRDVLVKGLHEAGWMVEC--PKASMYVWAKIPEQYA--------AMGSLEFAKKLLQD 353 Query: 358 AKVAVVPGIAFGLEGYFRISYATSMEELEEACIRIERACGSISIKSSLRGD 408 AKV V PGI FG G + +A L E RI +A IKS R D Sbjct: 354 AKVCVSPGIGFGDYGDTHVRFA-----LIENRDRIRQAVR--GIKSMFRAD 397 Lambda K H 0.317 0.135 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 358 Number of extensions: 19 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 409 Length of database: 412 Length adjustment: 31 Effective length of query: 378 Effective length of database: 381 Effective search space: 144018 Effective search space used: 144018 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory