Align acetylornithine deacetylase (EC 3.5.1.16) (characterized)
to candidate BWI76_RS12865 BWI76_RS12865 acetylornithine deacetylase
Query= BRENDA::Q92Y75 (374 letters) >FitnessBrowser__Koxy:BWI76_RS12865 Length = 389 Score = 276 bits (707), Expect = 5e-79 Identities = 150/378 (39%), Positives = 211/378 (55%), Gaps = 18/378 (4%) Query: 5 EILGKLVGFRSVVGLPNNDVVSWIRGYLESHGIAVDVLPGPEGDRSNIFATIGPKEARGY 64 EILG+L+ F + N +++WI +L + G+ + EG ++N++A +GP G Sbjct: 7 EILGQLLAFDTTSRESNLALIAWIGDFLRARGVTSQLFYDDEGRKANLYARLGPSGPGGV 66 Query: 65 IISGHMDVVPAAETGWTSDPFRLRVEADRLYGRGTTDMKGFLAAVLAAVPKLAAMPLRRP 124 ++SGH DVVP WT PF L R YGRG+ DMKGF+A VLA++ A PLR P Sbjct: 67 MLSGHTDVVPVDGQAWTVPPFALTERDGRYYGRGSADMKGFIACVLASLEAFLAAPLRMP 126 Query: 125 LHLALSYDEEAGCRGVPHMIARLPELCRQPLGAIIGEPTGMRAIRAHKGKAAARLTVRGR 184 LHLA SYDEE GC GV ++ L +P IIGEPT MR + HKGK A R V G Sbjct: 127 LHLAFSYDEEVGCLGVRSLVDFLRASAEKPALCIIGEPTDMRPVYGHKGKLAVRCRVEGH 186 Query: 185 SGHSSRPDQGLNAIHGVAGVLTQAVAEADRLVGGPFEHVFEPPYSSLQIGTVKGGQAVNI 244 + HS+ QG+NAI A ++ + A + + F PP +LQ+GT++GG+A+NI Sbjct: 187 ACHSAYAPQGVNAISYAAKLIYRLDALGESF-SQHLDRRFSPPSGTLQVGTIRGGEALNI 245 Query: 245 IPDSCEVEFEARAISGVDP------------AELLAPVRKTAEALTTLGFEVEWQELSAY 292 +P SC +FE R + G P +LL +RK A+ ++ +Q LS Y Sbjct: 246 VPQSCWFDFEIRYLPGTRPQAVTDALGDYAREQLLPAMRKVAQC-----SDIHFQTLSHY 300 Query: 293 PALSLEPDAPLAALLEELTGREALPAVSYGTEAGLFQRAGIDAIICGPGDIGRAHKPDEY 352 P L +P + A L + G + V+YGTE GLF AG+ +ICGPG + + H+ DEY Sbjct: 301 PGLLSDPQSAFARWLAQWCGSDDFTTVAYGTEGGLFDEAGVATLICGPGSMAQGHRADEY 360 Query: 353 ILIDELMACRAMVEALGA 370 I I + C AM++ L A Sbjct: 361 ISIPQTERCLAMLDNLCA 378 Lambda K H 0.319 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 373 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 374 Length of database: 389 Length adjustment: 30 Effective length of query: 344 Effective length of database: 359 Effective search space: 123496 Effective search space used: 123496 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate BWI76_RS12865 BWI76_RS12865 (acetylornithine deacetylase)
to HMM TIGR01892 (argE: acetylornithine deacetylase (ArgE) (EC 3.5.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01892.hmm # target sequence database: /tmp/gapView.29573.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01892 [M=365] Accession: TIGR01892 Description: AcOrn-deacetyl: acetylornithine deacetylase (ArgE) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-117 379.1 0.0 1.2e-117 378.9 0.0 1.0 1 lcl|FitnessBrowser__Koxy:BWI76_RS12865 BWI76_RS12865 acetylornithine de Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Koxy:BWI76_RS12865 BWI76_RS12865 acetylornithine deacetylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 378.9 0.0 1.2e-117 1.2e-117 1 364 [. 7 376 .. 7 377 .. 0.96 Alignments for each domain: == domain 1 score: 378.9 bits; conditional E-value: 1.2e-117 TIGR01892 1 eilakLvafdsvsarsnvdlieyvedyleelgvavevlpvadgaeksnllaviGpkegagglvlsGhtDvv 71 eil++L+afd++s+ sn++li ++ d+l++ gv+ + +g k nl a Gp+ g gg++lsGhtDvv lcl|FitnessBrowser__Koxy:BWI76_RS12865 7 EILGQLLAFDTTSRESNLALIAWIGDFLRARGVTSQLFYDDEG-RKANLYARLGPS-GPGGVMLSGHTDVV 75 79*******************************9999888888.9*********87.59************ PP TIGR01892 72 PvdeaaWtsDpfrLtekdgrLYgrGtaDmkGFlalvLaavpdlaaakLkkPlhlvlsaDeevglaGakkli 142 Pvd++aWt pf Lte+dgr YgrG+aDmkGF+a+vLa + aa+L+ Plhl++s+Deevg++G+++l+ lcl|FitnessBrowser__Koxy:BWI76_RS12865 76 PVDGQAWTVPPFALTERDGRYYGRGSADMKGFIACVLASLEAFLAAPLRMPLHLAFSYDEEVGCLGVRSLV 146 *********************************************************************** PP TIGR01892 143 eala...rrpalaivGePtslvavRahkGkasakvtvrGreghssrpdrGvsaielaakllarlvaladkl 210 + l ++pal i+GePt++++v hkGk + + +v+G+ hs+++ +Gv+ai aakl+ rl al + lcl|FitnessBrowser__Koxy:BWI76_RS12865 147 DFLRasaEKPALCIIGEPTDMRPVYGHKGKLAVRCRVEGHACHSAYAPQGVNAISYAAKLIYRLDALGESF 217 98766679*************************************************************98 PP TIGR01892 211 kredleeaFtppyatlniGtvkGGkavniiaaaCelvlelRpipGmdpeellallekiaee.....vkeka 276 ++l+ F pp tl++Gt++GG+a ni++++C + +e+R +pG p++++ l + a e +++ a lcl|FitnessBrowser__Koxy:BWI76_RS12865 218 S-QHLDRRFSPPSGTLQVGTIRGGEALNIVPQSCWFDFEIRYLPGTRPQAVTDALGDYAREqllpaMRKVA 287 7.5799*************************************************9999887887565666 PP TIGR01892 277 pgfevkveelsatpaleleedaelvalleklaGa.aaevvsygteagllqelGieavvlGPGdidqahqpd 346 +++ ++ls +p+l ++++ ++ l++ G+ +v+ygte gl+ e+G+ ++++GPG++ q h++d lcl|FitnessBrowser__Koxy:BWI76_RS12865 288 QCSDIHFQTLSHYPGLLSDPQSAFARWLAQWCGSdDFTTVAYGTEGGLFDEAGVATLICGPGSMAQGHRAD 358 778999***************************9899********************************** PP TIGR01892 347 eYveieelkrcrallerl 364 eY+ i + +rc a+l +l lcl|FitnessBrowser__Koxy:BWI76_RS12865 359 EYISIPQTERCLAMLDNL 376 **************9875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (365 nodes) Target sequences: 1 (389 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.64 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory