GapMind for Amino acid biosynthesis

 

Alignments for a candidate for proA in Klebsiella michiganensis M5al

Align Gamma-glutamyl phosphate reductase; GPR; Glutamate-5-semialdehyde dehydrogenase; Glutamyl-gamma-semialdehyde dehydrogenase; GSA dehydrogenase; EC 1.2.1.41 (characterized)
to candidate BWI76_RS05835 BWI76_RS05835 gamma-glutamyl-phosphate reductase

Query= SwissProt::P07004
         (417 letters)



>FitnessBrowser__Koxy:BWI76_RS05835
          Length = 417

 Score =  694 bits (1791), Expect = 0.0
 Identities = 351/417 (84%), Positives = 386/417 (92%)

Query: 1   MLEQMGIAAKQASYKLAQLSSREKNRVLEKIADELEAQSEIILNANAQDVADARANGLSE 60
           MLEQMGIAAK ASYKLAQLSSREKN+VLEKIAD LEAQ++ IL ANA+D+A+ARANGLSE
Sbjct: 1   MLEQMGIAAKAASYKLAQLSSREKNQVLEKIADYLEAQTDAILRANAEDLAEARANGLSE 60

Query: 61  AMLDRLALTPARLKGIADDVRQVCNLADPVGQVIDGGVLDSGLRLERRRVPLGVIGVIYE 120
           A+LDRLAL PARL GIA+DVRQVC+LADPVGQVIDGG+LDSGLR+ERRRVPLGV+GVIYE
Sbjct: 61  ALLDRLALNPARLSGIANDVRQVCSLADPVGQVIDGGLLDSGLRIERRRVPLGVVGVIYE 120

Query: 121 ARPNVTVDVASLCLKTGNAVILRGGKETCRTNAATVAVIQDALKSCGLPAGAVQAIDNPD 180
           ARPNVTVDVASLCLKTGNA ILRGGKET RTNAATV VIQ AL+ CGLPA  VQAI++PD
Sbjct: 121 ARPNVTVDVASLCLKTGNAAILRGGKETWRTNAATVKVIQQALQECGLPAATVQAIESPD 180

Query: 181 RALVSEMLRMDKYIDMLIPRGGAGLHKLCREQSTIPVITGGIGVCHIYVDESVEIAEALK 240
           RALV EML+MDKYIDMLIPRGGAGLHKLCREQSTIPVITGGIGVCHIY+D S ++AEALK
Sbjct: 181 RALVGEMLKMDKYIDMLIPRGGAGLHKLCREQSTIPVITGGIGVCHIYIDHSADVAEALK 240

Query: 241 VIVNAKTQRPSTCNTVETLLVNKNIADSFLPALSKQMAESGVTLHADAAALAQLQAGPAK 300
           VIVNAK QRPS CN+VETLLV+++IA+ FLPALSKQMAESGV+LHADAA+L  LQ GPA 
Sbjct: 241 VIVNAKVQRPSACNSVETLLVHQDIAERFLPALSKQMAESGVSLHADAASLPALQNGPAS 300

Query: 301 VVAVKAEEYDDEFLSLDLNVKIVSDLDDAIAHIREHGTQHSDAILTRDMRNAQRFVNEVD 360
           V  VKAE+YD+E+LSLDLNVK+V+D D+A+AHIREHGTQHSDAILTR + NA RF+NEVD
Sbjct: 301 VEPVKAEQYDNEYLSLDLNVKVVADQDEAVAHIREHGTQHSDAILTRTLGNANRFINEVD 360

Query: 361 SSAVYVNASTRFTDGGQFGLGAEVAVSTQKLHARGPMGLEALTTYKWIGIGDYTIRA 417
           SSAVYVNASTRFTDGGQFGLGAEVAVSTQKLHARGPMGLEALTTYKWIG GD TIRA
Sbjct: 361 SSAVYVNASTRFTDGGQFGLGAEVAVSTQKLHARGPMGLEALTTYKWIGFGDDTIRA 417


Lambda     K      H
   0.317    0.133    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 627
Number of extensions: 15
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 417
Length of database: 417
Length adjustment: 31
Effective length of query: 386
Effective length of database: 386
Effective search space:   148996
Effective search space used:   148996
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

Align candidate BWI76_RS05835 BWI76_RS05835 (gamma-glutamyl-phosphate reductase)
to HMM TIGR00407 (proA: glutamate-5-semialdehyde dehydrogenase (EC 1.2.1.41))

Software error:

../bin/blast/fastacmd -i /tmp/list.18103.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.18103.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.