Align Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 (characterized)
to candidate 199472 SO0277 ornithine carbamoyltransferase (NCBI ptt file)
Query= SwissProt::Q9K4Y9 (301 letters) >FitnessBrowser__MR1:199472 Length = 301 Score = 399 bits (1024), Expect = e-116 Identities = 188/299 (62%), Positives = 239/299 (79%) Query: 1 MENLLSVKDLSKQQILDLLALAKAVKANPAEYSQALAGKSIVTIYEKPSLRTRVTFDIGI 60 M++ LS+K+L++QQ+LDL+ LAK +KANPAEY AL GKS+V ++EKPSLRTRV+FDIGI Sbjct: 1 MKHFLSIKELTQQQLLDLITLAKTIKANPAEYRHALDGKSVVMLFEKPSLRTRVSFDIGI 60 Query: 61 HKLGGHAVYLDAQNGAIGERETVKDFAANISRWADAIVARVVSHKTLEGLVEHGSVPVVN 120 +K GGH +YLD QNGA+G+RE+V DFA+N+S WADAIVAR SH T+E L E G+VPV+N Sbjct: 61 NKFGGHCLYLDQQNGALGKRESVADFASNLSCWADAIVARTYSHTTIEQLAEFGTVPVIN 120 Query: 121 SLCDLYHPCQALADFLTISEHYEDVSKVKLAYVGEGNNVTHSLMLTGAILGAEVTAVCPR 180 +L DLYHPCQALADFLT++EH+E++S VKLAYVG+GNNVT+SLM AILGA +T +CP Sbjct: 121 ALSDLYHPCQALADFLTLAEHFENISDVKLAYVGDGNNVTNSLMYCAAILGATMTVICPA 180 Query: 181 GSSPDAQIVKQAMALAEISGGKINVTDNLDDIVDYDVIYGDTWVSMGDDTPLAQVKEKYM 240 G PD +V + LA GGKI +T ++D I +D IY DTW+SMGD TPLA++K+K+ Sbjct: 181 GHFPDGYVVAEVQELASRYGGKIVLTSDIDAIEGHDAIYTDTWISMGDPTPLAEIKDKFA 240 Query: 241 PYQINKALLMRTGIKHVLHCQPAHRELEITSEVMDGEHSLIFDQAENRMHAQNAVLLTL 299 PYQ+N AL+ + G +HC PAHR +E+T VMDGE SLI QAENRMHAQNAVL+TL Sbjct: 241 PYQVNNALMAKAGAHFFMHCLPAHRGVEVTDAVMDGECSLILQQAENRMHAQNAVLVTL 299 Lambda K H 0.317 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 274 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 301 Length adjustment: 27 Effective length of query: 274 Effective length of database: 274 Effective search space: 75076 Effective search space used: 75076 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate 199472 SO0277 (ornithine carbamoyltransferase (NCBI ptt file))
to HMM TIGR00658 (argF: ornithine carbamoyltransferase (EC 2.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00658.hmm # target sequence database: /tmp/gapView.24924.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00658 [M=304] Accession: TIGR00658 Description: orni_carb_tr: ornithine carbamoyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-108 348.8 0.0 1.4e-108 348.6 0.0 1.0 1 lcl|FitnessBrowser__MR1:199472 SO0277 ornithine carbamoyltransf Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__MR1:199472 SO0277 ornithine carbamoyltransferase (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 348.6 0.0 1.4e-108 1.4e-108 1 303 [. 2 300 .. 2 301 .] 0.98 Alignments for each domain: == domain 1 score: 348.6 bits; conditional E-value: 1.4e-108 TIGR00658 1 rhllslldlseeelkellelakklkkekkkgkeekklkgktlaliFekrstRtRvsfevaayelGaqvlylnkeelqlg 79 +h+ls+++l++++l +l+ lak++k++ + ++ l gk++ ++Fek+s RtRvsf++++ ++G++ lyl++++ lg lcl|FitnessBrowser__MR1:199472 2 KHFLSIKELTQQQLLDLITLAKTIKANPAE--YRHALDGKSVVMLFEKPSLRTRVSFDIGINKFGGHCLYLDQQNGALG 78 79************************9998..5668******************************************* PP TIGR00658 80 rkesikDtarvlsryvdaivvRvykhedveelakyasvPvingLtdlehPcqilaDlltikeklgklkevklvyvGDan 158 ++es++D a ls + daiv+R+y+h+++e+la++ +vPvin+L+dl hPcq+laD+lt+ e+++++++vkl+yvGD+n lcl|FitnessBrowser__MR1:199472 79 KRESVADFASNLSCWADAIVARTYSHTTIEQLAEFGTVPVINALSDLYHPCQALADFLTLAEHFENISDVKLAYVGDGN 157 ******************************************************************************* PP TIGR00658 159 nvanslllaaaklGldvvvatPeglepeaeivkkakkiakenggkleltedpkkavkdadviytDvwvsmGeeekkeer 237 nv+nsl+ aa lG +++v +P g p+ +v + +++a+++ggk+ lt+d+ +a+++ d iytD+w+smG+ + +e lcl|FitnessBrowser__MR1:199472 158 NVTNSLMYCAAILGATMTVICPAGHFPDGYVVAEVQELASRYGGKIVLTSDI-DAIEGHDAIYTDTWISMGDPTPLAEI 235 ***************************************************8.69*********************9** PP TIGR00658 238 lkllkpyqvneellelakpevkflhCLPavrGeevtdevlegeasivfdeaenRlhaqkavlkall 303 + + pyqvn+ l++ a f+hCLPa+rG evtd v++ge s++ ++aenR+haq avl++l+ lcl|FitnessBrowser__MR1:199472 236 KDKFAPYQVNNALMAKAGA-HFFMHCLPAHRGVEVTDAVMDGECSLILQQAENRMHAQNAVLVTLF 300 **************99865.57****************************************9886 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (301 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.50 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory