Align Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 (characterized)
to candidate 199237 SO0040 shikimate 5-dehydrogenase (NCBI ptt file)
Query= SwissProt::Q9KVT3 (278 letters) >FitnessBrowser__MR1:199237 Length = 287 Score = 284 bits (726), Expect = 2e-81 Identities = 146/277 (52%), Positives = 188/277 (67%), Gaps = 6/277 (2%) Query: 5 IDQYAVFGNPINHSKSPFIHTLFARQTQQSMIYTAQCVPVDGFTEAAKHFFAQGGRGCNV 64 +D+YAVFG+PI HSKSPFIH FA TQ+S+ Y A P+DGF + K FF+ GG+G NV Sbjct: 8 VDRYAVFGHPIGHSKSPFIHGQFAALTQESLTYEAILAPIDGFEASLKSFFSSGGKGANV 67 Query: 65 TVPFKEEAYRFADRLTERARLAGAVNTLKKLDDGEILGDNTDGEGLVQDLLAQQVLLKGA 124 TVPFKE+A+ D L+ A LAGAVNTL L DG I GDNTDG GLV DL++ L+ Sbjct: 68 TVPFKEQAFALCDSLSAEAALAGAVNTLSLLADGSIRGDNTDGLGLVADLISHLGSLQHK 127 Query: 125 TILLIGAGGAARGVLKPLLDQQPASITVTNRTFAKAEQLAELVAAYGE------VKAQAF 178 +LL+GAGGAARG + PLL+ + +TNRT KA+ L ++ + E ++A + Sbjct: 128 RVLLVGAGGAARGCILPLLNAGVGQLVITNRTQTKAKDLVDIFSQLEEGIYKDKLQALSM 187 Query: 179 EQLKQSYDVIINSTSASLDGELPAIDPVIFSSRSVCYDMMYGKGYTVFNQWARQHGCAQA 238 +L ++++INSTSASL GELP + I S +VCYDMMYG T FNQWA Q G A+ Sbjct: 188 SELTGEFELVINSTSASLAGELPPLPQSIIGSTTVCYDMMYGAMPTAFNQWALQQGAAKV 247 Query: 239 IDGLGMLVGQAAESFMLWRGLRPGTKQILRELRKNLE 275 IDGLGMLVGQAA+SF LWR + P T +L+ LR+ L+ Sbjct: 248 IDGLGMLVGQAAKSFALWRTVEPDTAVVLKLLREKLQ 284 Lambda K H 0.320 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 203 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 287 Length adjustment: 26 Effective length of query: 252 Effective length of database: 261 Effective search space: 65772 Effective search space used: 65772 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate 199237 SO0040 (shikimate 5-dehydrogenase (NCBI ptt file))
to HMM TIGR00507 (aroE: shikimate dehydrogenase (EC 1.1.1.25))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00507.hmm # target sequence database: /tmp/gapView.29700.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00507 [M=270] Accession: TIGR00507 Description: aroE: shikimate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-86 276.4 0.0 1.2e-86 276.3 0.0 1.0 1 lcl|FitnessBrowser__MR1:199237 SO0040 shikimate 5-dehydrogenase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__MR1:199237 SO0040 shikimate 5-dehydrogenase (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 276.3 0.0 1.2e-86 1.2e-86 3 269 .. 11 283 .. 9 284 .. 0.96 Alignments for each domain: == domain 1 score: 276.3 bits; conditional E-value: 1.2e-86 TIGR00507 3 lgviGnpikhSksplihnaalkqlgleleYlafeveieelekalsgikalglkGvnvTvPfKeevlellDeieesakli 81 ++v+G+pi hSksp+ih ++++ ++ l+Y a+ ++i+ +e l+ +++ g kG+nvTvPfKe++++l+D ++ +a+l+ lcl|FitnessBrowser__MR1:199237 11 YAVFGHPIGHSKSPFIHGQFAALTQESLTYEAILAPIDGFEASLKSFFSSGGKGANVTVPFKEQAFALCDSLSAEAALA 89 9****************************************************************************** PP TIGR00507 82 gavNTlk.ledgklvgynTDgiGlvssLek.lsklksekrvliiGAGGaakavaleLlka.dkeviiaNRtvekaeela 157 gavNTl l dg + g+nTDg+Glv++L l l+ +krvl++GAGGaa++ +l+Ll+a +++i+NRt+ ka++l+ lcl|FitnessBrowser__MR1:199237 90 GAVNTLSlLADGSIRGDNTDGLGLVADLIShLGSLQ-HKRVLLVGAGGAARGCILPLLNAgVGQLVITNRTQTKAKDLV 167 *******99*******************999*****.***********************5579*************** PP TIGR00507 158 erlqe......lgeilalsleevelkkvdliinatsaglsgeideaevkaellkegklvvDlvynpletpllkeakkkg 230 + + + + +als++e+ +++l+in+tsa+l ge+ ++++++++ + ++++D++y + t++ ++a ++g lcl|FitnessBrowser__MR1:199237 168 DIFSQleegiyKDKLQALSMSELTG-EFELVINSTSASLAGEL--PPLPQSIIGSTTVCYDMMYGAMPTAFNQWALQQG 243 ****988888556678999988865.6****************..********************************** PP TIGR00507 231 .tkvidGlgMlvaQaalsFelwtgvepdvekvfealkekl 269 +kvidGlgMlv Qaa+sF lw+ vepd +v + l+ekl lcl|FitnessBrowser__MR1:199237 244 aAKVIDGLGMLVGQAAKSFALWRTVEPDTAVVLKLLREKL 283 99********************************999998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (287 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.01 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory