GapMind for Amino acid biosynthesis

 

Alignments for a candidate for glyXS in Shewanella oneidensis MR-1

Align UPF0237 protein MMP0657 (characterized, see rationale)
to candidate 201040 SO1878 glycine cleavage system transcriptional repressor, putative (NCBI ptt file)

Query= uniprot:Q6LZH1
         (90 letters)



>FitnessBrowser__MR1:201040
          Length = 183

 Score = 45.4 bits (106), Expect = 3e-10
 Identities = 23/68 (33%), Positives = 43/68 (63%), Gaps = 5/68 (7%)

Query: 4  VVITVVGVDKPGIVAEVTKVLAQNSANIVDIRQTIMEDLFTMIMLV-----DISKISSDF 58
          +V+T +G+D+PG+V+++ ++ +    +IVD R  +  + FT+IM++      I+KI S  
Sbjct: 5  LVVTAMGLDRPGLVSKLARLASDCDCDIVDSRMALFGNEFTLIMMLSGSWASITKIESLL 64

Query: 59 SELNVALE 66
            L+V LE
Sbjct: 65 PSLSVELE 72


Lambda     K      H
   0.320    0.136    0.355 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 29
Number of extensions: 1
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 90
Length of database: 183
Length adjustment: 14
Effective length of query: 76
Effective length of database: 169
Effective search space:    12844
Effective search space used:    12844
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 41 (20.4 bits)

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory