Align Histidinol dehydrogenase; HDH; EC 1.1.1.23 (characterized)
to candidate 201230 SO2073 histidinol dehydrogenase (NCBI ptt file)
Query= SwissProt::P06988 (434 letters) >FitnessBrowser__MR1:201230 Length = 438 Score = 479 bits (1234), Expect = e-140 Identities = 249/437 (56%), Positives = 322/437 (73%), Gaps = 13/437 (2%) Query: 6 IIDWNSCTAEQQRQLLMRPAISASESITRTVNDILDNVKARGDEALREYSAKFDKTTVTA 65 ++ W + +A++Q+ L R + + ++V I+D V +RGD A++E++ KFD + Sbjct: 3 MLTWAALSADEQKTALQRSPLIGDSGLEQSVRAIVDAVASRGDAAIKEFNQKFDGARLAN 62 Query: 66 --------LKVSAEEIAAASERLSDELKQAMAVAVKNIETFHTAQKLPPVDVETQPGVRC 117 L++S EI AAS R+S ELK A+A A+ NI+ FH+AQ+ P+D+ETQ GVRC Sbjct: 63 ISSANSDNLRLSEHEIEAASARVSPELKAAIAQAMANIDVFHSAQQFRPIDIETQAGVRC 122 Query: 118 QQVTRPVASVGLYIPGGSAPLFSTVLMLATPASIAGCKKVVLCSPPPIADEILYAAQLCG 177 + + P+ VGLYIPGGSAPL STVLMLA PA+IAGC++ VL SPPPI D I+YAA +CG Sbjct: 123 ELRSEPIEKVGLYIPGGSAPLISTVLMLALPATIAGCEQRVLVSPPPINDAIVYAANVCG 182 Query: 178 VQDVFNVGGAQAIAALAFGTESVPKVDKIFGPGNAFVTEAKRQVSQRLDG---AAIDMPA 234 + +++ VGGAQAIAALAFGTE++P VDKIFGPGN +VTEAKR VSQ DG +IDMPA Sbjct: 183 ITEIYQVGGAQAIAALAFGTETIPSVDKIFGPGNRYVTEAKRLVSQ--DGRCTVSIDMPA 240 Query: 235 GPSEVLVIADSGATPDFVASDLLSQAEHGPDSQVILLTPAADMARRVAEAVERQLAELPR 294 GPSEVLVIADS A F+A+DLLSQAEHGPDSQVIL+T + +A+ V +A++ QLA LPR Sbjct: 241 GPSEVLVIADSDANAQFIAADLLSQAEHGPDSQVILVTDSLPLAQAVNQALKSQLAALPR 300 Query: 295 AETARQALNASRLIVTKDLAQCVEISNQYGPEHLIIQTRNARELVDSITSAGSVFLGDWS 354 E A AL SR I+ KD+ + +SN+YGPEHLIIQTR RE++++I +AGSVFLG ++ Sbjct: 301 QEIAATALKGSRTILVKDMQEAALVSNRYGPEHLIIQTRFPREVLNNIRAAGSVFLGAYT 360 Query: 355 PESAGDYASGTNHVLPTYGYTATCSSLGLADFQKRMTVQELSKEGFSALASTIETLAAAE 414 PES GDYASGTNHVLPTYGY+ SSL LADF +R TVQELS +G L + TLA+ E Sbjct: 361 PESVGDYASGTNHVLPTYGYSRAVSSLSLADFSRRFTVQELSAKGLLGLGQAVMTLASNE 420 Query: 415 RLTAHKNAVTLRVNALK 431 L AHKNAV +R+ +LK Sbjct: 421 LLDAHKNAVAVRLASLK 437 Lambda K H 0.315 0.128 0.356 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 467 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 434 Length of database: 438 Length adjustment: 32 Effective length of query: 402 Effective length of database: 406 Effective search space: 163212 Effective search space used: 163212 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
Align candidate 201230 SO2073 (histidinol dehydrogenase (NCBI ptt file))
to HMM TIGR00069 (hisD: histidinol dehydrogenase (EC 1.1.1.23))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00069.hmm # target sequence database: /tmp/gapView.22135.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00069 [M=393] Accession: TIGR00069 Description: hisD: histidinol dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.3e-157 508.3 2.0 9.4e-157 508.2 2.0 1.0 1 lcl|FitnessBrowser__MR1:201230 SO2073 histidinol dehydrogenase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__MR1:201230 SO2073 histidinol dehydrogenase (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 508.2 2.0 9.4e-157 9.4e-157 1 393 [] 33 432 .. 33 432 .. 0.98 Alignments for each domain: == domain 1 score: 508.2 bits; conditional E-value: 9.4e-157 TIGR00069 1 vkeiiedvrkeGdeAlleytekfdkv........kleslrvseeeleealeavdeelkealelaaeniekfhekqlpes 71 v++i+++v ++Gd+A++e+++kfd++ + ++lr+se+e+e+a+++v++elk+a+++a++ni+ fh++q+ + lcl|FitnessBrowser__MR1:201230 33 VRAIVDAVASRGDAAIKEFNQKFDGArlanissaNSDNLRLSEHEIEAASARVSPELKAAIAQAMANIDVFHSAQQFRP 111 789*********************98778777777789***************************************** PP TIGR00069 72 veveteegvllgqkvrplervglYvPgGkaaypStvlmtavpAkvAgvkeivvvtPpkkdgkvnpavlaaakllgvdev 150 + +et++gv ++ + +p+e+vglY+PgG+a+++Stvlm+a+pA +Ag+++ v+v+Pp +n+a+++aa+++g++e+ lcl|FitnessBrowser__MR1:201230 112 IDIETQAGVRCELRSEPIEKVGLYIPGGSAPLISTVLMLALPATIAGCEQRVLVSPPP----INDAIVYAANVCGITEI 186 *********************************************************6....***************** PP TIGR00069 151 ykvGGaqaiaalayGtetvpkvdkivGPGniyVtaAKklvf..g..evgidmiaGPsEvlviadesanpelvaaDllsq 225 y+vGGaqaiaala+Gtet+p+vdki+GPGn yVt+AK+lv+ g +v+idm+aGPsEvlviad++an++++aaDllsq lcl|FitnessBrowser__MR1:201230 187 YQVGGAQAIAALAFGTETIPSVDKIFGPGNRYVTEAKRLVSqdGrcTVSIDMPAGPSEVLVIADSDANAQFIAADLLSQ 265 *****************************************662568******************************** PP TIGR00069 226 aEHdedaqailvttseelaekveeeveeqleelerkeiaekslekngaiilvddleealelsneyApEHLelqtkdpee 304 aEH++d+q+ilvt+s la++v++++++ql++l+r+eia ++l+ ++ ilv+d++ea+ +sn+y+pEHL++qt+ p+e lcl|FitnessBrowser__MR1:201230 266 AEHGPDSQVILVTDSLPLAQAVNQALKSQLAALPRQEIAATALK-GSRTILVKDMQEAALVSNRYGPEHLIIQTRFPRE 343 ********************************************.788899**************************** PP TIGR00069 305 llkkiknaGsvflGeytpealgdyvaGpnhvLPTsgtArfasglsvedFlkrisvqelskealeelaeaveklaeaEgL 383 +l++i++aGsvflG+ytpe++gdy++G+nhvLPT+g++r+ s+ls++dF +r++vqels ++l l++av++la+ E L lcl|FitnessBrowser__MR1:201230 344 VLNNIRAAGSVFLGAYTPESVGDYASGTNHVLPTYGYSRAVSSLSLADFSRRFTVQELSAKGLLGLGQAVMTLASNELL 422 ******************************************************************************* PP TIGR00069 384 eaHaeavevR 393 +aH++av+vR lcl|FitnessBrowser__MR1:201230 423 DAHKNAVAVR 432 *******998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (393 nodes) Target sequences: 1 (438 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 8.27 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory